Dmul008261.1
Basic Information
- Insect
- Drosophila multiciliata
- Gene Symbol
- ham_5
- Assembly
- GCA_037043605.1
- Location
- JBAMBF010000374.1:2034224-2035042[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.00049 1.7 8.8 0.1 26 45 7 26 2 29 0.91 2 3 0.00069 2.3 8.3 0.6 21 45 30 54 26 59 0.89 3 3 6.4e-05 0.22 11.6 0.3 20 45 58 83 53 87 0.89
Sequence Information
- Coding Sequence
- atgCCCGCAGATCGCTACACGTGCAAGTTTTGTGGCAAGGTGTTTCCACGCTCCGCGAATCTCACGCGACATCTGCGCACCCACACGGGTGAGCAGCCGTACAAGTGCAAATACTGCGAACGTTCCTTTAGCATCTCCTCGAATCTGCAGCGCCATGTGCGCAACATCCACAACAAGGAGCGACCCTTCAAGTGTGAGATCTGCGAACGATGCTTTGGCCAGCAAACGAATCTCGATCGCCATCTCAAGAAGCACGAATCGGATGCAGTTTCGCTGAGTGCGCTGAGCGGGGTAAGCGAGCGAATGCACTGTATAAGACGCTTCTGTGAGAATCCCAGCGAGGAGTCCTATTTCGAGGAGATACGCTCATTTATGGGCAAGGtcacccagcagcagcaacagcaacaggaacagcagcagcagcatcagcaacatcaacaacaactacagtcACTGCCTCTGGCAACGCAATCACGCAGCTCAGCATCATCGAGCTGCTCTGCCTCAGACACGCCCACATCCTCGCATACGCCCACGCAATCATCGGAGTCAGCGGAAGCGCTGGCGGTGGAGCTCAAGCCAATTGACAAAAACGCTCGCCTCAAAACTCCACACTTTcccacaactacaacaacaacaccaacaacaaaagcagccgAAAAGTTAACGCTGAAGCAGGAACCCTAA
- Protein Sequence
- MPADRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPSEESYFEEIRSFMGKVTQQQQQQQEQQQQHQQHQQQLQSLPLATQSRSSASSSCSASDTPTSSHTPTQSSESAEALAVELKPIDKNARLKTPHFPTTTTTTPTTKAAEKLTLKQEP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00552554;
- 90% Identity
- iTF_00552554;
- 80% Identity
- iTF_00552554;