Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 4.1e-06 0.0047 17.1 8.8 19 63 2 47 1 52 0.69

2 3 0.0018 2 8.6 0.7 3 20 65 82 63 90 0.83

3 3 0.00026 0.29 11.3 1.0 54 70 90 106 84 106 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	4.1e-06	0.0047	17.1	8.8	19	63	2	47	1	52	0.69
2	3	0.0018	2	8.6	0.7	3	20	65	82	63	90	0.83
3	3	0.00026	0.29	11.3	1.0	54	70	90	106	84	106	0.87

Coding Sequence: ATGATTGAACAAGTGAGAAGTGAGGCAACAGTGCTAATCCTTGAGCATTTTCATTCCAGCACCTTCTGCTGCTGCTGCTGCCTGGACTACATTGTGCCCTGCAAGCAAACCGATCGCAGTCATTATTGCGGCAACTGCGGCTTCAGCATGGTTGAAGAACTGACGCCCGTCTATTTTGCCGTTGGCCCCAATGCTCGGGAAGTTACCTGTCCGTATTGCAAGGTGCTGGCGAAGACTCGGCTGGTGCGTTCCTGGCCGCACTTATGCACTAAACGTCATCACTGCGGCGCTTGCGGCGAATATCTGGGTGTCTACAGGCGACCCCAGCTATAA
Protein Sequence: MIEQVRSEATVLILEHFHSSTFCCCCCLDYIVPCKQTDRSHYCGNCGFSMVEELTPVYFAVGPNAREVTCPYCKVLAKTRLVRSWPHLCTKRHHCGACGEYLGVYRRPQL

Sequence clustering based on sequence similarity using MMseqs2