Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.55 5.3e+03 -2.9 0.0 5 14 8 17 5 17 0.72

2 5 0.00019 1.8 8.2 0.2 11 26 29 44 25 47 0.88

3 5 0.00019 1.8 8.2 0.2 11 26 54 69 50 72 0.88

4 5 0.00019 1.8 8.2 0.2 11 26 79 94 75 97 0.88

5 5 0.00023 2.2 7.9 0.4 11 26 104 119 100 121 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.55	5.3e+03	-2.9	0.0	5	14	8	17	5	17	0.72
2	5	0.00019	1.8	8.2	0.2	11	26	29	44	25	47	0.88
3	5	0.00019	1.8	8.2	0.2	11	26	54	69	50	72	0.88
4	5	0.00019	1.8	8.2	0.2	11	26	79	94	75	97	0.88
5	5	0.00023	2.2	7.9	0.4	11	26	104	119	100	121	0.88

Coding Sequence: atgaCCACGGTTTCTTTGTGCAAACAGAACCGTATTCGGGTTTCCAGTTATCTCAGTGCTCTTTTCATCGTCAATGCTATTCTTATAAGCAAGTTCCGCTGGCGTACCTTCATCGATATACGCCGCTTCAAGGAGTTTGCCATCGTCAATGCTATTCTTATAAGCAAGTTCCGCTGGCGTACCTTCATCGATATACGCCGCTTCAAGGAGTTTGCCATCGTCAATGCTATTCTTATAAGCAAGTTCCGCTGGCGTACCTTCATCGATATACGCCGCTTCAAGGAGTTTGCCATCGTCAATGCTATTCTTATAAGCAAGTTCCGCTGGCGTACCTTCATCGATATACGCCGCTTCAAGGAGTTTGCGTAA
Protein Sequence: MTTVSLCKQNRIRVSSYLSALFIVNAILISKFRWRTFIDIRRFKEFAIVNAILISKFRWRTFIDIRRFKEFAIVNAILISKFRWRTFIDIRRFKEFAIVNAILISKFRWRTFIDIRRFKEFA

Sequence clustering based on sequence similarity using MMseqs2