Dmau003536.1
Basic Information
- Insect
- Drosophila mauritiana
- Gene Symbol
- -
- Assembly
- GCA_004382145.1
- Location
- NC:4398366-4399447[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.52 4.5e+02 0.7 2.6 52 67 9 24 5 27 0.77 2 3 3.2 2.8e+03 -1.8 0.8 35 35 101 101 75 120 0.54 3 3 5.6e-08 4.8e-05 23.1 6.1 5 70 149 206 145 206 0.88
Sequence Information
- Coding Sequence
- ATGTCGAAGCAAAATATTCAGAAAGACCAAGATGAGTGCCTTCGTTGCATGCGCTGCAAGAAAGTGATCCAATGTTCACGTTTCGATAGCGGTAGCTTACTGCGTCACATCGAATATGAGCATCCGGAATTATTCAAGATGGCCCATTCCAaagtcaaaagtatttacaatcCCTCAACGGATAAGAGATCGGATTCGGAACTTGATGCTGAAAGTTTGGGGCGATGTAAGAACAAAAAGAGGACCTCTAGCGATGACATGACCAAAAAATCATCGATTACCAGGTGCAATGTGGCTGCTGCCAACTCTACATGTCCGCACTCAAAAGCCAAGTACAGTAAATGTCCAAAAGCCAAGACCACTGGTCCGTGTTCGCCGCACCACTTGATCTTTCGCAAGATGGCCTACAAGACCTCCGCCAGGCGATGGTGTGCCATGGATGGCAGTATCTTCTGCCCCGCTTGCGGTTATAAGAAGCGTCCAGTGATCAAATGCGCATCGGATTGGAATTCCAGATGGTGTTCATGGGCCCTTTGCTTTATGCCCTGTCTGAATAACTCGGATGATGGGGAGAAGATTTACTGCGGTCACTGTAACACCTTTTTGGGCGTCTACAATCGCCAAAGGCAAAGTCTCAAGCCGAACAAGCTGTATGCCTGA
- Protein Sequence
- MSKQNIQKDQDECLRCMRCKKVIQCSRFDSGSLLRHIEYEHPELFKMAHSKVKSIYNPSTDKRSDSELDAESLGRCKNKKRTSSDDMTKKSSITRCNVAAANSTCPHSKAKYSKCPKAKTTGPCSPHHLIFRKMAYKTSARRWCAMDGSIFCPACGYKKRPVIKCASDWNSRWCSWALCFMPCLNNSDDGEKIYCGHCNTFLGVYNRQRQSLKPNKLYA
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00592770;
- 90% Identity
- -
- 80% Identity
- -