Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 8.9e-06 0.0026 18.5 0.0 5 33 2 30 1 33 0.92

2 3 0.0031 0.91 10.3 0.0 84 109 62 87 50 88 0.85

3 3 0.04 12 6.8 0.0 79 108 89 118 85 120 0.83

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	8.9e-06	0.0026	18.5	5	33	2	30	1	33	0.92
2	3	0.0031	0.91	10.3	84	109	62	87	50	88	0.85
3	3	0.04	12	6.8	79	108	89	118	85	120	0.83

Coding Sequence: ATGTTTAATACCAAAGAATTGGCCGATGTGACAATCGCGACAGCCGACGGACAAAAGATTCCAGTTCACAAGAACATATTAACAGcacgAGTTGTGTTGAAATTAAGGATTTCAGTTACGATGTTGTCTCGGAGCTTATCGATTCATGTACACGGGGGAAGCGCCAAACTTGAACTTGGAGATGCCGAACTTCTGGCGGCCGCTGACAAATACGGGCTGGACAGACTGAAATCGATGTGTGCCAAAGTAATGAGCGATAATCTCAGCATGGAAAATGCACATGCAGTGCTAAAGTCAGCCGATCTTTACAACTTGCCAGATGTCAAACTCAAGACAATTCGATCAATTCAAACTAATATTGAAAAGGAAACTGGCAAGACAAAGTACGTCGATTTACTACAAGTTTTTATAGAGCAAAAGCTTCAGgaattaaaactaaatgatGCCTCCCTCGAGCAGCCAAcgaaatga
Protein Sequence: MFNTKELADVTIATADGQKIPVHKNILTARVVLKLRISVTMLSRSLSIHVHGGSAKLELGDAELLAAADKYGLDRLKSMCAKVMSDNLSMENAHAVLKSADLYNLPDVKLKTIRSIQTNIEKETGKTKYVDLLQVFIEQKLQELKLNDASLEQPTK

Sequence clustering based on sequence similarity using MMseqs2