Dinc005943.1
Basic Information
- Insect
- Drosophila incognita
- Gene Symbol
- -
- Assembly
- GCA_035042225.1
- Location
- JAWNLQ010000240.1:48632-49671[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.4e-25 9.5e-23 80.2 13.7 1 69 71 139 71 140 0.96
Sequence Information
- Coding Sequence
- ATGGATAGTGCTCAACCCAACACGAAGCCGGAGTTGCCCAAGGACGAGGTGAGTGGACAAGTGCATGAGgcggagcaacagcaattgctgatgccaccagcaccacccagCTACGATCAGGCAACGACCACGCCCGCACAGACAACGGGACCTGgggccacaacagcaacacagcaCACTGTGATCGTTGTCCCATCCTCGCCATACGGACCCGATCCCCAGGACGTACAGTGTCCCTACTGCCACAACTTTACGCGCACCCGCGTCTCCTACAGACCCAATTCCCGAACGCACCTAATTGCGCTGGTGCTGTGCCTGTTCCAACTTTACTGCTGTGTGTGCCTGCCCTACTGCATTTCCAGCTGCATGAACACGAATCACTACTGTGGCATGTGCGATCGGTACCTGGGCACCTATTTGCGTAAATAG
- Protein Sequence
- MDSAQPNTKPELPKDEVSGQVHEAEQQQLLMPPAPPSYDQATTTPAQTTGPGATTATQHTVIVVPSSPYGPDPQDVQCPYCHNFTRTRVSYRPNSRTHLIALVLCLFQLYCCVCLPYCISSCMNTNHYCGMCDRYLGTYLRK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00525556;
- 90% Identity
- iTF_00620258; iTF_00486243; iTF_00544132; iTF_00560709; iTF_00567206; iTF_00610312; iTF_00495530; iTF_00528463; iTF_00593519; iTF_00497813; iTF_00511670; iTF_00497050; iTF_00499258; iTF_00482653; iTF_00597821; iTF_00607485; iTF_00500703; iTF_00552703; iTF_00517377; iTF_00596322; iTF_00498534; iTF_00518825; iTF_00502187; iTF_00565038; iTF_00583345; iTF_00599249; iTF_00553430; iTF_00513848; iTF_00576731; iTF_00577435; iTF_00557565; iTF_00499966; iTF_00514558; iTF_00616575; iTF_00574475; iTF_00535724; iTF_00559159; iTF_00525556; iTF_00549217; iTF_00522610;
- 80% Identity
- -