Dhyd000698.1
Basic Information
- Insect
- Drosophila hydei
- Gene Symbol
- -
- Assembly
- GCA_003285905.2
- Location
- NW:328025-329662[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 9.6e-29 7.8e-26 89.6 16.4 2 70 65 133 64 133 0.97
Sequence Information
- Coding Sequence
- ATGGAAAAGCAGCCACCGCCATATAGTGCAATGCCGCAACCGCAGCCTGGCTATACGCCTGCACAGACCTATCAGCCTTATCCGGGTGGACCCACACAGCCACCGCTGTATCCACCCATGCCACAGCCACCGCAACAATCCACCGTGATCATACAGACGACAACCACATCCAATTTGGTGCCCATTGGCAGTGGGCCGACACGCATACGTTGCCCCTCCTGTCAAGCCGAGGTGGTGACAACTGTTAAGAGCACACCCTCTGGTCGTACTCATTGCTGGGCATTGATACTATGTCTGTTTATTTGCTGGCCCTGCGTGTGTTTGCCCTACTGCATGGATTCCTGTCAGAATGCCAATCACTATTGCCCCAATTGCAGCTCCTACATAGGCACCTACGAGAACTAA
- Protein Sequence
- MEKQPPPYSAMPQPQPGYTPAQTYQPYPGGPTQPPLYPPMPQPPQQSTVIIQTTTTSNLVPIGSGPTRIRCPSCQAEVVTTVKSTPSGRTHCWALILCLFICWPCVCLPYCMDSCQNANHYCPNCSSYIGTYEN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00607481;
- 90% Identity
- iTF_00572981; iTF_00547030; iTF_00610305; iTF_00593514; iTF_00497806; iTF_00521816; iTF_00567199; iTF_00560704; iTF_01356513; iTF_00513123; iTF_00901901; iTF_00832572; iTF_00498531; iTF_00542819; iTF_00557562; iTF_00599971; iTF_00584838; iTF_01320134; iTF_00518823; iTF_00502184; iTF_00565035; iTF_00583342; iTF_00599246; iTF_00553427; iTF_00513845; iTF_00570773; iTF_00576728; iTF_00577432; iTF_00499963; iTF_00514556; iTF_00616572; iTF_00486239; iTF_00596319; iTF_00473448; iTF_00479841; iTF_00549930; iTF_00554740; iTF_00528456; iTF_01326057; iTF_00491178; iTF_00551246; iTF_00531350; iTF_00497807; iTF_00559153; iTF_00574467; iTF_00597812; iTF_00497040; iTF_00482648; iTF_00502911;
- 80% Identity
- -