Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 1.4e-12 1.2e-09 37.7 6.5 2 69 44 115 43 116 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	1.4e-12	1.2e-09	37.7	6.5	2	69	44	115	43	116	0.81

Coding Sequence: ATGCCGAGCGAGCCGAGTAAGGAATTGGAAGAGGTGGATCTGGAGGCGGACAACAATTCGGCGGCCACCACGGCCACGCTGGAGGGAAGTACTGGCAAGCCGCAGGTGCGGTTCTTCAGCATCGGCCCCAGCAGCTATCAGGTGCGCTGTCCGCTCTGCCAGCAGGATTCCAAGACGGAGACGGTGGAGATGACTGGCGCACTGGGTCAGCTCAGCTGCCTGCTCTCCGCCCTGTCTTGCTGCTTCCCGATCTTCGCCCTGACCTTTGTGTACTCGTGCCTGCAGAGTCGCCTCAAGACCAAACGGGTCTTCTGCAGCAGATGCGGCGGACACTTGGGCTTCCACTGGCGTCCCACTTAA
Protein Sequence: MPSEPSKELEEVDLEADNNSAATTATLEGSTGKPQVRFFSIGPSSYQVRCPLCQQDSKTETVEMTGALGQLSCLLSALSCCFPIFALTFVYSCLQSRLKTKRVFCSRCGGHLGFHWRPT

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00527719;
90% Identity: iTF_00601435; iTF_00603751; iTF_00564328; iTF_00474895; iTF_00611735; iTF_00581204; iTF_00518121; iTF_00472042; iTF_00474190; iTF_00575246; iTF_00481233; iTF_00536440; iTF_00484798;
80% Identity: -