Dfun009901.1
Basic Information
- Insect
- Drosophila fungiperda
- Gene Symbol
- -
- Assembly
- GCA_035042345.1
- Location
- JAWNLM010000178.1:15831-16247[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.1e-11 1.5e-08 34.5 8.7 2 69 43 114 42 115 0.83
Sequence Information
- Coding Sequence
- ATGACGAGCGCGTCGAATATGTTGCATGATCTGGAGCAGGACGCAGACACTGTCTCTGCTGCGACTGTCACGCTGGAGATGGATGAGGAACGGAAGCCGCAGTTGCGCTTCTACAGCGTCGGTCCGAGCACCTATCGTGTCCGTTGTCCCCTCTGTCAGCAGCGTTCCCGCTCCGAAACGGTGCAAATGACAGGCGCTTTGGGCCAGCTCAGCTGTTTGCTCTCCGTCCTGTCCTGttGCTTTCCCATCTTTGCACTGAGCTGCGTTTACTCCTGCCTGCAGAGCCGTCTGAAGAGCAAGCGCGTCttctgcagcagctgtggcgGTCACTTGGGCTTCCATTGGCGCCCCATTTAG
- Protein Sequence
- MTSASNMLHDLEQDADTVSAATVTLEMDEERKPQLRFYSVGPSTYRVRCPLCQQRSRSETVQMTGALGQLSCLLSVLSCCFPIFALSCVYSCLQSRLKSKRVFCSSCGGHLGFHWRPI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00587081;
- 90% Identity
- iTF_00500708; iTF_00552709; iTF_00544139; iTF_00544140; iTF_00535736; iTF_00535738; iTF_00535739; iTF_00499264; iTF_00511680; iTF_00553441; iTF_00570785; iTF_00576741; iTF_00522630; iTF_00577446; iTF_00499977; iTF_00514569; iTF_00517385; iTF_00616586; iTF_00486251; iTF_00549227; iTF_00596333; iTF_00518836; iTF_00502197; iTF_00583354; iTF_00599260; iTF_00525565; iTF_00565055; iTF_00513856; iTF_00497059; iTF_00559169; iTF_00482660; iTF_00597833; iTF_00620266; iTF_00521835; iTF_00560716; iTF_00567215; iTF_00610319; iTF_00528470; iTF_00574486; iTF_00593526; iTF_00497824; iTF_00557575; iTF_00498543; iTF_00542833; iTF_00495538; iTF_00607494;
- 80% Identity
- iTF_00511680;