Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.8 1.8e+03 -1.0 1.5 5 15 13 23 7 30 0.71

2 3 9.1 9.1e+03 -3.3 0.7 48 61 110 123 107 135 0.58

3 3 1.4e-10 1.4e-07 31.4 5.5 6 70 180 238 177 238 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.8	1.8e+03	-1.0	1.5	5	15	13	23	7	30	0.71
2	3	9.1	9.1e+03	-3.3	0.7	48	61	110	123	107	135	0.58
3	3	1.4e-10	1.4e-07	31.4	5.5	6	70	180	238	177	238	0.88

Coding Sequence: ATGTCTCAGACAAACTTAGCGAAGAGCGATGAGCATTGCATGCGTTGTTTGCACTGCATGCAGGTGGTCCGTTGCTCTCGATACGATACTAGTGCACTAGTGCGCCACATCGAACTGGAACACCCGGACATATTCTCGGTGGCCAGCAGCAAGATCAGGAATGTCCACAAGCTGGACTCAGAACAAGGATCTAGCGGAGACTGTATAAGCAAAACCACTGGACCCTCTGAACCAAAGAAACCAATGGACGAACAGTTTGATCCATTGTGGTTTGATAACCATTGCAGTGGAGATGCCCAAGGCAAAAATGATTCCACTGCGGGGTGCTGTGCTGCGGCTGCCAAAAAGACCACCGATCCATGTTCGAATGCCAAGAATAAAACATGTCCAGATCCCAAGGAGCATCCCGGATCGTGTCTCAAGAAGCAATCGCTTCCCATTTCCAAGGTCGAGACATGTACTTGTGCCGAAATTAAGCAGATTCGCAAGAAGTACTATCGAGCTTCCGTGGAGCGTTGGCGTGCCGTGGATGGGTTAATTTTGTGCCCAGCCTGCGGGATCAAGAGTCGTCCGTTGATTAAGACGTCCGCGGAAGTGAATTCCGGATGCTGGGCCAACTGCTGGCCATTCTGCTACTTTCCCTGTCTGATGTCCTCCGACAAGCAGGTGTACCTACACTGCGGCCAGTGCAAGATTTTTTTGGGCATCTACAATCGCGAGAAAAACAGCGTGAGACCCAACAAGGAGTTCGTGTAA
Protein Sequence: MSQTNLAKSDEHCMRCLHCMQVVRCSRYDTSALVRHIELEHPDIFSVASSKIRNVHKLDSEQGSSGDCISKTTGPSEPKKPMDEQFDPLWFDNHCSGDAQGKNDSTAGCCAAAAKKTTDPCSNAKNKTCPDPKEHPGSCLKKQSLPISKVETCTCAEIKQIRKKYYRASVERWRAVDGLILCPACGIKSRPLIKTSAEVNSGCWANCWPFCYFPCLMSSDKQVYLHCGQCKIFLGIYNREKNSVRPNKEFV

Sequence clustering based on sequence similarity using MMseqs2