Dfic011100.1
Basic Information
- Insect
- Drosophila ficusphila
- Gene Symbol
- E2f2_1
- Assembly
- GCA_018152265.1
- Location
- JAECXK010000405.1:5827201-5827682[+]
Transcription Factor Domain
- TF Family
- E2F
- Domain
- E2F_TDP domain
- PFAM
- PF02319
- TF Group
- Helix-turn-helix
- Description
- This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.27 1.4e+03 -1.1 0.0 19 34 38 53 14 56 0.67 2 2 2.4e-24 1.3e-20 72.7 0.1 4 57 82 134 79 142 0.89
Sequence Information
- Coding Sequence
- ATGTACAAGCGCAAAACAGCGAGTATTGTTAAAAGAGACAGCAGCTCCGTAGTGGGAACCTCCTCCACGGTTATGATGATGATGGGCGCTGGCAACGTGGAAGCGGATGCATCTCCAGCCAAGTCGGTATCGTACGAGACCGCGTCTGTCAAAATGGAAACATCGCCGGATCCACCCACGCCGATAAAGTCCCCGTCGCAATCCCAATCTCAGTCACAGCCCGGTCAACAGCGTTCCGTAGGCTCGCTGGTTCTGCTCACCCAAAAGTTTGTGGAGCTAATGAAGGCTAACGGGGGGACCATCGATTTAAAAGCGGCCACTAAAATCTTGGACGTGCAGAAGCGTCGAATTTACGATATTACCAATGTTTTGGAGGGCATTGGACTGATAGATAAAGGCAGACACTGCTCCCTAGTGCGCTGGCGGTAG
- Protein Sequence
- MYKRKTASIVKRDSSSVVGTSSTVMMMMGAGNVEADASPAKSVSYETASVKMETSPDPPTPIKSPSQSQSQSQPGQQRSVGSLVLLTQKFVELMKANGGTIDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -