Dere006884.1
Basic Information
- Insect
- Drosophila erecta
- Gene Symbol
- -
- Assembly
- GCA_000005135.1
- Location
- CH954179.1:7418153-7418616[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.4e-13 1e-09 38.4 15.8 2 68 50 119 49 121 0.78
Sequence Information
- Coding Sequence
- ATGACGACAACGCTGCCGAAGAAGGAAGCGGAAACGCAGCAGGAGATCAGGGAGCGGGAGGCCAAGGCTCTGGAGGATCGCAAGGAGCGCAAGATCTACGAGAACTTTGCCACGCCACTGGCAGGCACTTTCCTCAACCTGCCACACGAGCCCGTGGAGATCAAGTGCCCCGCCTGCGGCATTAAGGAGCTGAGTGTGGTGCAGAATGATCTGAAGTGGTGGGCCAGTGAAATTAACCGCATTGTGGGCTGTCTTTTCGTGaccttctgttgctgctgctgcttcaatTACTTTGTGCCCTGCAAGCAAACCGATCGAAGTCATTACTGCGGCAATTGCGGCTGCTACTTTGGACGTTCTATGAAGAGGAGGCAACCACTCAAATTGAAGGCAACCACCGCCTAG
- Protein Sequence
- MTTTLPKKEAETQQEIREREAKALEDRKERKIYENFATPLAGTFLNLPHEPVEIKCPACGIKELSVVQNDLKWWASEINRIVGCLFVTFCCCCCFNYFVPCKQTDRSHYCGNCGCYFGRSMKRRQPLKLKATTA*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00494785; iTF_00605254; iTF_00486985; iTF_00540041; iTF_00597033; iTF_00605993; iTF_00512396; iTF_00578960; iTF_00603026; iTF_00608114; iTF_00515927; iTF_00543416; iTF_00548473; iTF_00505786; iTF_00507997; iTF_00581949; iTF_00619517; iTF_00537182; iTF_00588542; iTF_00529951; iTF_00592767; iTF_00586357; iTF_00534262; iTF_00584107; iTF_00602258; iTF_00566465; iTF_00615875; iTF_00477700; iTF_00488390; iTF_00539334; iTF_00476299; iTF_00504364; iTF_00481904; iTF_00546328; iTF_00550617; iTF_00580350; iTF_00615263; iTF_00609551; iTF_00611736; iTF_00487685; iTF_00515271; iTF_00518120; iTF_00603752; iTF_00472041; iTF_00564329; iTF_00474189; iTF_00575247; iTF_00474896; iTF_00481232; iTF_00581205; iTF_00359896; iTF_00536441; iTF_00601436; iTF_00484797; iTF_00562141; iTF_00562142;
- 90% Identity
- iTF_00529951;
- 80% Identity
- -