Ddif008850.1
Basic Information
- Insect
- Drosophila differens
- Gene Symbol
- Ssb-c31a_1
- Assembly
- GCA_037043665.1
- Location
- JBAMAZ010000283.1:3652036-3652463[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.7e-27 8.1e-23 79.6 0.1 1 51 55 105 55 106 0.96
Sequence Information
- Coding Sequence
- atgccaaaaataaggaaacaaaaaagttcCTCATCTGACAGCGACAGCGGTCCAGAAGATcgCAATCCGCCGCCGGCAAGTAAGAAGGCAAAGGAGGATAGCACCTCGAACAAAGCCAATAAGAATGAATCGGCTGTCAAGGGTGGAGATGGCACTTCCACATGGACACTGGAGGGTATGCGCCAGGTGCGCATCAACGAATTTCGTGGTCGCAAAATGGTCGACATACGCGAACACTACGAAAAGGACGGCAAAGTATTGCCGGGCAAAAAGGGTATATCGCTGTCGGCTTCGCAGTGGCGAAAACTGCTCGCCTGTGCCGATGATGTTACTCGCGCCCTCGAAGAATGA
- Protein Sequence
- MPKIRKQKSSSSDSDSGPEDRNPPPASKKAKEDSTSNKANKNESAVKGGDGTSTWTLEGMRQVRINEFRGRKMVDIREHYEKDGKVLPGKKGISLSASQWRKLLACADDVTRALEE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00516993;
- 90% Identity
- iTF_00577065; iTF_00498155; iTF_00542443; iTF_00518444; iTF_00595948; iTF_00557213; iTF_00516993; iTF_00514180; iTF_00598885; iTF_00485863; iTF_00616200; iTF_00564654; iTF_00501808; iTF_00553040; iTF_00582961; iTF_00513468; iTF_00570398; iTF_00576350; iTF_00619843; iTF_00574052; iTF_00543750; iTF_00566795; iTF_00495116; iTF_00521356; iTF_00497389; iTF_00558670; iTF_00511280; iTF_00593104; iTF_00528051; iTF_00597364; iTF_00560277; iTF_00552312; iTF_00500313; iTF_00496602; iTF_00482236; iTF_00607069; iTF_00498878; iTF_00609887; iTF_00535316;
- 80% Identity
- iTF_00577065; iTF_00518444; iTF_00595948;