Dcol001574.1
Basic Information
- Insect
- Drosophila colorata
- Gene Symbol
- -
- Assembly
- GCA_035041545.1
- Location
- JAWNLD010000016.1:6495062-6495492[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1e-10 8.4e-08 32.2 8.3 3 69 49 119 47 120 0.83
Sequence Information
- Coding Sequence
- ATGTCAAGCGCGCCGAACATGTTGTACGAActggagcaggagctggaTAATGACTCTGCTGTCACCGCCacgctggagctggagctggagccgcagcagccgccgctgaAGCCGCAGCTGCGCTTCTACAGCGTTGGCCCCAGCACCTATCGCGTGCTCTGCCCGCTGTGCCAGCATCGCTCGCGCTCGGAAACGGTGCAAATGGCCGGCGCTTTGGGCCAGCTCAGCTGCCTGCTGTCCGCCTTATCCTGCTGCTTTCCCATCTTCGCGCTGAGCTGCGTCTACTCGTGCCTGCAGAGCCGGCTGAAGAGCAAGCGCGtcttctgcagcagctgcggcggcCATTTGGGCTTCCACTGGCGTCCCATTTAG
- Protein Sequence
- MSSAPNMLYELEQELDNDSAVTATLELELEPQQPPLKPQLRFYSVGPSTYRVLCPLCQHRSRSETVQMAGALGQLSCLLSALSCCFPIFALSCVYSCLQSRLKSKRVFCSSCGGHLGFHWRPI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00559169; iTF_00497059; iTF_00482660; iTF_00607494; iTF_00597833; iTF_00620266; iTF_00521835; iTF_00560716; iTF_00610319; iTF_00495538; iTF_00528470; iTF_00574486; iTF_00497824; iTF_01320865; iTF_00524099; iTF_00604515; iTF_00501480; iTF_00612491; iTF_00618832; iTF_00591381; iTF_00556247; iTF_00578200; iTF_00503673; iTF_00484122; iTF_00600732; iTF_00571583; iTF_01320146; iTF_00576741; iTF_00589225; iTF_00530629; iTF_00598557; iTF_01323787; iTF_01327562; iTF_01326839; iTF_01325336; iTF_01328282; iTF_01322317; iTF_01324572; iTF_00538639; iTF_00508774; iTF_00569384; iTF_01556500; iTF_00531363; iTF_00491191; iTF_00551259; iTF_00803279; iTF_00582639; iTF_01326068; iTF_01321589; iTF_00804057; iTF_00805645; iTF_00806367;
- 90% Identity
- iTF_00531363;
- 80% Identity
- -