Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 4.9 1.5e+04 -1.9 0.0 26 32 79 85 74 100 0.74

2 7 0.00014 0.42 12.7 0.0 21 43 102 124 97 133 0.88

3 7 0.00038 1.2 11.3 0.2 21 44 130 153 125 158 0.88

4 7 0.0017 5.2 9.2 0.0 21 44 158 181 153 186 0.90

5 7 0.03 93 5.2 0.0 19 43 185 209 179 214 0.85

6 7 0.095 2.9e+02 3.6 0.1 22 44 216 238 212 246 0.84

7 7 2.3 7.2e+03 -0.9 0.1 22 36 246 260 242 272 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	4.9	1.5e+04	-1.9	0.0	26	32	79	85	74	100	0.74
2	7	0.00014	0.42	12.7	0.0	21	43	102	124	97	133	0.88
3	7	0.00038	1.2	11.3	0.2	21	44	130	153	125	158	0.88
4	7	0.0017	5.2	9.2	0.0	21	44	158	181	153	186	0.90
5	7	0.03	93	5.2	0.0	19	43	185	209	179	214	0.85
6	7	0.095	2.9e+02	3.6	0.1	22	44	216	238	212	246	0.84
7	7	2.3	7.2e+03	-0.9	0.1	22	36	246	260	242	272	0.73

Coding Sequence: ATGGAAGAAACTATTATTAAGGAAGAAACTAATGATTTGGTGTTGAATGAGGAATTGGGATCATTGCTGAAAGAGATAAAGGAGGAAAAAAATGAAGTGGAAGAAAATGCGGTAATGTCGACTGAAAGTGAACCGTTTTCAAAACAATATAAATGTGATGTTTGTGATAAGTCATTCGAGCGGTTGCCCATTTTAAGGCAGCATCGTTTGGTACATGTCCGAGCAAAAAAATTTACGTGCGAAATTTGCAACGAATCATTTCTACGCGCTTATGGTTTGAAGTTGCATAAACTTGTGCACACCGGAGAAAAACCATTCACGTGTGAATTTTGCAACCAATCATTCAAACAATCACGTTACTTAAAACAACACCGTTTAACGCACACAGGTGAAAAACCATACACTTGCGAAGTTTGCAACCAAACATTCAGACAAAGGACCCATTTAAAAAAACACTCTTTATTGCATTCTGATGAAAAACCATACACTTGTGAAATCTGCGATCAGTCATTCAGACAGCTAACTTATCTAAAAGAACACTTTGTTTCGCATACTATGGGAAATAGACCTTTtaagtgtgaagtttgcaacaagaCATTCCGACAAATGCAAAGCTTGAAGTATCATAATtatatacacactggtgaactGCCATTTTCTTGCCATATTTGCAAGAAATCATTCCGGCATCCGAACTATTTAAAACAGCATAAACTTCTACACGCTAACAAGAACACCAGACCATATTCCTGTGAAATTTGCAACTTGGCTTTCAAGAAGGAAATCggtttgacagctcataaatatTCACACCATTCACACGTTGAGGAAGAGATAATTACGCCtgatttataa
Protein Sequence: MEETIIKEETNDLVLNEELGSLLKEIKEEKNEVEENAVMSTESEPFSKQYKCDVCDKSFERLPILRQHRLVHVRAKKFTCEICNESFLRAYGLKLHKLVHTGEKPFTCEFCNQSFKQSRYLKQHRLTHTGEKPYTCEVCNQTFRQRTHLKKHSLLHSDEKPYTCEICDQSFRQLTYLKEHFVSHTMGNRPFKCEVCNKTFRQMQSLKYHNYIHTGELPFSCHICKKSFRHPNYLKQHKLLHANKNTRPYSCEICNLAFKKEIGLTAHKYSHHSHVEEEIITPDL

Sequence clustering based on sequence similarity using MMseqs2