Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0083 25 7.0 0.1 7 43 118 154 113 157 0.87

2 6 0.0012 3.7 9.7 0.0 20 46 157 183 155 189 0.83

3 6 0.0013 4 9.5 0.0 21 45 186 210 181 219 0.84

4 6 0.25 7.6e+02 2.2 0.1 21 44 214 237 211 241 0.88

5 6 0.00012 0.36 12.9 0.2 7 51 228 272 225 275 0.79

6 6 0.33 1e+03 1.8 0.1 21 43 270 292 265 297 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0083	25	7.0	0.1	7	43	118	154	113	157	0.87
2	6	0.0012	3.7	9.7	0.0	20	46	157	183	155	189	0.83
3	6	0.0013	4	9.5	0.0	21	45	186	210	181	219	0.84
4	6	0.25	7.6e+02	2.2	0.1	21	44	214	237	211	241	0.88
5	6	0.00012	0.36	12.9	0.2	7	51	228	272	225	275	0.79
6	6	0.33	1e+03	1.8	0.1	21	43	270	292	265	297	0.86

Coding Sequence: ATGTTTGTTGTAAATAATTATGATACAAACGATTTAAAATCGCAAATGATGAAGAATGAAGGTATGGGAGatagtgaaaaaattattattaaagaagaaaatttcCAAGATGACACATGTCCTGATTTTGTTGATGTAAAAGCAAATAtattcgatgaaaatatttcaaaagcacAAAGTGAAATGATTAAGTATGTACctaaaattgaagaattcattataaaagaagaaaatgaaTTAAATGAAGATGTACCtaatattgaagaaattattattaaagaaacaaatgaaaaattagtatTAGATGATGAATTAAACGCATTACTGCATGACGTCAAAGGAGAAAATTCTAAATGTGATAACAGTACCGAAAATATCAAAGATAAATCTTGTAATAAAAAGTTGTTTGAATGTGAAATATGCAACAGAACATTCCGATGTTTGAAGAATTTAAAGAAGCATAAACATACTAGCGAAAAACCACAAACTTGTGATGTTTGCAATAAAACATTCCGGCACAtgggaaatttcaatatgcaccGTTTGTTACACACtggagaaaaaccatttacttgtgaagtttgcaataaatcattcgcGCATTCaagcaatttgaaaaatcatcatttaatacacactggagaaaaaccattcatttgtgaagtttgcaacacaTCATTCAAACATCCTTATCTTCTAAAGAGGCATAAAcgtgtacacactggtgaaaaaccatttacttgtgaagtgtGCAATAAAACATTCAGGCATTCGCACACTTTGAAGGCTCACCGGTTATTACACACTGGAGAAAAACCgtttatttgtgaagtttgtaataaacCGTTCAGACATCTTCAAGTTCTAAagaagcataaacttatacacattggttga
Protein Sequence: MFVVNNYDTNDLKSQMMKNEGMGDSEKIIIKEENFQDDTCPDFVDVKANIFDENISKAQSEMIKYVPKIEEFIIKEENELNEDVPNIEEIIIKETNEKLVLDDELNALLHDVKGENSKCDNSTENIKDKSCNKKLFECEICNRTFRCLKNLKKHKHTSEKPQTCDVCNKTFRHMGNFNMHRLLHTGEKPFTCEVCNKSFAHSSNLKNHHLIHTGEKPFICEVCNTSFKHPYLLKRHKRVHTGEKPFTCEVCNKTFRHSHTLKAHRLLHTGEKPFICEVCNKPFRHLQVLKKHKLIHIG

Sequence clustering based on sequence similarity using MMseqs2