Dqua010957.1
Basic Information
- Insect
- Dromius quadrimaculatus
- Gene Symbol
- -
- Assembly
- GCA_963989225.1
- Location
- OZ022325.1:67813717-67814421[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.065 2e+02 4.1 0.2 25 44 25 44 15 48 0.87 2 7 8.6e-06 0.027 16.5 0.1 20 43 48 71 44 76 0.89 3 7 0.0039 12 8.0 0.1 21 43 77 99 72 104 0.90 4 7 0.0046 14 7.8 0.1 21 43 105 127 103 132 0.87 5 7 0.00015 0.46 12.6 0.0 21 47 133 159 130 164 0.85 6 7 0.011 33 6.6 0.2 22 46 162 185 159 192 0.83 7 7 0.0081 25 7.0 0.1 23 45 191 213 188 219 0.89
Sequence Information
- Coding Sequence
- ATGTGCAGCAAATCCTACAAATTCTCCCAAAATTTAATCAAGCACCAAATCGCCCACGCAAACAAAAAACAATACACGTGTGAAGTCTGTCAAAAATCATTCCAACAATTGCGGCATTTAAAAGACCACCATTCAGTGCACACCGGCGAAAAACCTTTCACATGTGACGTTTGCAACCGCTCATTCAGACAACTACGCAATTTAAAGCAGCACCGCTTGGGGCACACCGGCGAAAAACCTTTCACGTGTGAagtctgcaataaatcattcaaagaaTTGCCTCATTTACGAAGACATAATTTAATACATACTGGCGAGAAACCTTTTACTTGTGAGGTTTGTAATAAATCGTTTAGACAGTTGCCGCATTTAAAAGAGCATCATTTGACGCACACTGGCGAAAAACCATTCacgtgtgaagtttgcaatgaTTCGTTTAGACATTCAAAAACTTTAAAACAGCATAAACTTTTACATACTGGGGATAAACCGTTTACTTGTGATGTTTGTAATCAGAGTTTTAGACAGTTGCCTCATTTGCAACATCATCAGCTGACGCACACAGGCGGGAAACCATTCAGCTGTGAAATTTGCAGCACATCTTTTACCACCAAACGAAACTTATTGCATCATTTGAGGAGCCATCAATCAAAAACAACTAGCAAGAAACATGGTTTTGATTCACGTAGGAAGAAAAAACAGTGa
- Protein Sequence
- MCSKSYKFSQNLIKHQIAHANKKQYTCEVCQKSFQQLRHLKDHHSVHTGEKPFTCDVCNRSFRQLRNLKQHRLGHTGEKPFTCEVCNKSFKELPHLRRHNLIHTGEKPFTCEVCNKSFRQLPHLKEHHLTHTGEKPFTCEVCNDSFRHSKTLKQHKLLHTGDKPFTCDVCNQSFRQLPHLQHHQLTHTGGKPFSCEICSTSFTTKRNLLHHLRSHQSKTTSKKHGFDSRRKKKQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00470263;
- 90% Identity
- iTF_00470263;
- 80% Identity
- iTF_00470263;