Dpar001655.1
Basic Information
- Insect
- Dorcus parallelipipedus
- Gene Symbol
- -
- Assembly
- GCA_958336345.1
- Location
- OY284475.1:14154477-14155117[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 2.9 1.3e+04 -2.2 0.1 58 66 6 14 4 17 0.65 2 3 0.15 7e+02 1.9 0.4 27 44 38 58 31 69 0.63 3 3 5.4e-16 2.5e-12 48.2 1.7 7 70 84 147 78 147 0.96
Sequence Information
- Coding Sequence
- ATGGCATCCGTAGGAAAATGTAAAATATGTGGGGAAACCTTAAACTATTCACCAGATGAAATCGCCTCCTTTGGCAAACACCTTTTAGACAAGCACGGCGCCGAAGAGATCACGCACTTCTCTTTTGCGGAAGTTACCGACTGCAAGTGCGGTTGCGGATGTGGGTGTACCTGCGGGAAAGCAGCAGATACAGACAAGAAAGCTTACAAGACGACAGTTGAAAGCTGGAAGCAGGGTGCTGTTGAACAGCTGTGTCCAAACTGTGGGAAACTCGGTTTTCCTCTGATACGCAAGCAAAGGAACAAAGTATCCAAAAACTCGTTTGGTACTCTATGTTTGGTGGGCTGTTGGCCTCTGTGTTTCTTGCCCTTCCTAATCGGTGGTAGTGACATCATGTATCTGTTCTGTCAGGAGTGCGGCTACTTTTTGGGCACTTACAACAGGAAGAACGGCCAGATCAATCCGTCCTGCCCCATTGATTCCAACGAATTCGGGGCTAAAGTCTGTAAATGTGAATCGCACGTCGCTGACAAATAA
- Protein Sequence
- MASVGKCKICGETLNYSPDEIASFGKHLLDKHGAEEITHFSFAEVTDCKCGCGCGCTCGKAADTDKKAYKTTVESWKQGAVEQLCPNCGKLGFPLIRKQRNKVSKNSFGTLCLVGCWPLCFLPFLIGGSDIMYLFCQECGYFLGTYNRKNGQINPSCPIDSNEFGAKVCKCESHVADK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01258901;
- 90% Identity
- iTF_01258901;
- 80% Identity
- -