Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 1.4 1.8e+03 0.6 0.0 27 52 15 40 10 41 0.83

2 8 0.52 6.5e+02 2.0 0.1 17 44 33 60 20 64 0.81

3 8 0.01 13 7.5 0.0 21 44 65 88 61 93 0.90

4 8 0.0064 8.1 8.1 0.0 21 44 93 116 90 124 0.85

5 8 0.013 16 7.1 0.1 21 44 121 144 117 149 0.89

6 8 0.75 9.4e+02 1.5 0.0 21 44 149 172 146 178 0.85

7 8 0.097 1.2e+02 4.3 0.2 22 44 178 200 174 205 0.88

8 8 0.019 24 6.6 0.1 21 44 205 228 203 233 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	1.4	1.8e+03	0.6	0.0	27	52	15	40	10	41	0.83
2	8	0.52	6.5e+02	2.0	0.1	17	44	33	60	20	64	0.81
3	8	0.01	13	7.5	0.0	21	44	65	88	61	93	0.90
4	8	0.0064	8.1	8.1	0.0	21	44	93	116	90	124	0.85
5	8	0.013	16	7.1	0.1	21	44	121	144	117	149	0.89
6	8	0.75	9.4e+02	1.5	0.0	21	44	149	172	146	178	0.85
7	8	0.097	1.2e+02	4.3	0.2	22	44	178	200	174	205	0.88
8	8	0.019	24	6.6	0.1	21	44	205	228	203	233	0.90

Coding Sequence: ATGATATTTGTATCTAACTTACTGGACGATAGAACATTCAGGTGCCACGTTTGCGATTCCAAATTTAAAACCCGCAAATGTCTCAACAAACACCTTTCGATACAtacgggcgagaagccgttcagttgtgacttTTGCGCGTACAAGTGCCGAGTAGCCGGATTTCTGAAGCAGCATATGCtgatacacaccgacgagaagccgttcagttgtgatctctgcgattacaaatgccgacaagGCGGGGCGCTGAAGCGGCATACGCtgatacacaccgacgagaaaccattctgctgtgatctttgcgattacaagagCCGAGATTCCGGTAACTTGAAACAACACGTGCTAACGCACACCAGccagaagccgttcagttgtaagCTGTGCGATTATAAATCCAGGCGGGCCTCAAATTTGAGACTTCACATGTTGGTGCACAACGACGAgaggccgttcagttgtgatctgtGCGATTATAAAGGCCGGCATCTGTCGACGATGAAACGACACATGTTGACGCACACCGGccagaagccgtttagttgtgatctgtgcgattacaagtgccggAGAGTCAGCAATTTGAAGCAGCATGTTTTAGTACACAATGACGAGAAGCCTTTTAGTTGTGACCTTTGTGACTATAAATGCCGAGAGGCGAGGAGATTGAAATCACACATGTTGATACATACCGGCGAAAAGCTGTAA
Protein Sequence: MIFVSNLLDDRTFRCHVCDSKFKTRKCLNKHLSIHTGEKPFSCDFCAYKCRVAGFLKQHMLIHTDEKPFSCDLCDYKCRQGGALKRHTLIHTDEKPFCCDLCDYKSRDSGNLKQHVLTHTSQKPFSCKLCDYKSRRASNLRLHMLVHNDERPFSCDLCDYKGRHLSTMKRHMLTHTGQKPFSCDLCDYKCRRVSNLKQHVLVHNDEKPFSCDLCDYKCREARRLKSHMLIHTGEKL

Sequence clustering based on sequence similarity using MMseqs2