Dpar001071.1
Basic Information
- Insect
- Dorcus parallelipipedus
- Gene Symbol
- zfy1
- Assembly
- GCA_958336345.1
- Location
- OY284475.1:8201918-8202403[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.038 48 5.6 0.0 21 44 10 33 2 38 0.90 2 5 3.8e-05 0.048 15.2 0.2 21 44 38 61 34 70 0.87 3 5 1.6 2e+03 0.4 0.0 21 44 66 89 61 93 0.77 4 5 0.0054 6.8 8.3 0.2 21 52 94 125 83 127 0.84 5 5 0.0088 11 7.7 0.5 22 48 123 148 119 153 0.86
Sequence Information
- Coding Sequence
- ATGAGGCGACACATGCTGACGCATTCCGGCGAGCGACCATACCTGTGTAATTTTTGCGACTACAAAGGTCGAGACAGCAGCTACCTGAAACGGCACATCTtgacgcacaccggcgagaaaccgtacACTTGCGATCTCTGCGGTTACAAATGCCGACAGAGCGcgaatttaaaacaacacaGGCTGACGCACGCCGGAGAGAAACCCTTCTCTTGCGATTTCTGCGGTTACAAGTGCGGGCTCgccggaaatttgaaaatacacaTGCGGATACACACCGATGAGAAACCGTACGCGTGTAACCTTTGCGACTACAAATGTCGATACCGCGGAAATCTGAAAAAGCACGTGCTGACGCACGCCCATAAGAAGCCTTACGTTTGTGATGTTTGCGGCTACAAATGTCGGCAGAGCTCGCATTTAAAACAACACAAGCTGAAACATACCGGCGATCGACCTCCGAACGTACAACGCGAGTACAGGTGA
- Protein Sequence
- MRRHMLTHSGERPYLCNFCDYKGRDSSYLKRHILTHTGEKPYTCDLCGYKCRQSANLKQHRLTHAGEKPFSCDFCGYKCGLAGNLKIHMRIHTDEKPYACNLCDYKCRYRGNLKKHVLTHAHKKPYVCDVCGYKCRQSSHLKQHKLKHTGDRPPNVQREYR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00466907;
- 90% Identity
- iTF_00466907;
- 80% Identity
- iTF_00466907;