Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 9.1 1.1e+04 -2.0 0.0 27 52 15 40 14 42 0.73

2 9 2.2 2.8e+03 -0.0 0.0 21 41 37 57 32 63 0.87

3 9 0.0017 2.1 10.0 0.1 21 44 65 88 62 93 0.91

4 9 0.055 70 5.1 0.0 21 49 93 121 90 126 0.83

5 9 0.96 1.2e+03 1.1 0.1 22 44 122 144 118 149 0.87

6 9 0.2 2.5e+02 3.3 0.3 21 43 149 171 146 176 0.84

7 9 0.0058 7.2 8.2 0.1 21 44 177 200 172 204 0.91

8 9 0.0026 3.2 9.4 0.2 21 46 205 230 201 236 0.86

9 9 0.21 2.6e+02 3.3 0.2 22 48 234 259 230 262 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	9.1	1.1e+04	-2.0	0.0	27	52	15	40	14	42	0.73
2	9	2.2	2.8e+03	-0.0	0.0	21	41	37	57	32	63	0.87
3	9	0.0017	2.1	10.0	0.1	21	44	65	88	62	93	0.91
4	9	0.055	70	5.1	0.0	21	49	93	121	90	126	0.83
5	9	0.96	1.2e+03	1.1	0.1	22	44	122	144	118	149	0.87
6	9	0.2	2.5e+02	3.3	0.3	21	43	149	171	146	176	0.84
7	9	0.0058	7.2	8.2	0.1	21	44	177	200	172	204	0.91
8	9	0.0026	3.2	9.4	0.2	21	46	205	230	201	236	0.86
9	9	0.21	2.6e+02	3.3	0.2	22	48	234	259	230	262	0.90

Coding Sequence: ATGATAATCGAAACTAACGTTCTGGGCCAAAGCGTATTCGAATGTCAGCTGTGCGGCTCTAAATTTAAAACTCGCGGATACATGCGCAAGCACATCCAgatacataccggcgagaaaccgttcggcTGTGATTTTTGCGAATACAAGTGCCGAAATGCCGGAAATCTGAAACTGGACTCGTTCatacataccggcgagaagccgttctgCTGCGAACATTGCGATTACAAGACTCGACAAGTCGGGAACCTAAAGCGGCACTTGTTAACGCACAccgatgagaagccgttcacttgCGACTGGTGCGCTTATAAAGGCCGAAATTTCTGGAAGCTGAAGCGtcacatgttaacgcacaccgTAGAGAAACCGTATTACTGCGACCTTTGCGACTACAAGTGCCGCGAAGCCGTGAGTTTGAAAGagcacatgttaatacacaccggcgagaggcCGTTCACTTGTAAAGTTTGCGGCTACAGATGCCGAAACGCCGGAATACTAAAGCAACACACCCTAACACACACCGATGAAAAGCCgtacagttgtgatctctgcgttTACAGGTGCCaccaatccggaaatttgaaaagtcacatgttaacgcacacaGATGAGAAGCCTTTCCGTTGTGAACACTGCGATTACAAAAGCCGTCAGATCGCAAATTTAAAACGGCACTTGTTAGTACACATCGGCGAAAAGCCGCTTAgctgtaatctttgcgattataaatgccgagaaaCGGGAAGATTGAAAATGCACATGTTAAGACACGCCGGTTTCAAGTGGCATGTGTCGAGACATACCGGCGAGAGCGCAACAGTCGTGCAAAATCAACCAGAAGATCCGATAAGTTGA
Protein Sequence: MIIETNVLGQSVFECQLCGSKFKTRGYMRKHIQIHTGEKPFGCDFCEYKCRNAGNLKLDSFIHTGEKPFCCEHCDYKTRQVGNLKRHLLTHTDEKPFTCDWCAYKGRNFWKLKRHMLTHTVEKPYYCDLCDYKCREAVSLKEHMLIHTGERPFTCKVCGYRCRNAGILKQHTLTHTDEKPYSCDLCVYRCHQSGNLKSHMLTHTDEKPFRCEHCDYKSRQIANLKRHLLVHIGEKPLSCNLCDYKCRETGRLKMHMLRHAGFKWHVSRHTGESATVVQNQPEDPIS

Sequence clustering based on sequence similarity using MMseqs2