Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.00026 0.33 12.6 0.1 21 47 6 32 3 39 0.84

2 11 1.2 1.5e+03 0.9 0.1 23 52 36 65 32 68 0.86

3 11 0.5 6.3e+02 2.0 0.2 21 44 62 85 50 90 0.87

4 11 0.16 2e+02 3.7 0.1 21 44 90 113 87 121 0.86

5 11 0.0023 2.9 9.5 0.1 21 44 118 141 114 150 0.86

6 11 0.63 7.9e+02 1.7 0.1 23 52 148 176 146 178 0.85

7 11 3.3 4.2e+03 -0.6 0.0 21 43 173 195 169 199 0.72

8 11 0.081 1e+02 4.6 0.2 13 44 193 224 185 232 0.83

9 11 0.76 9.6e+02 1.5 0.0 23 45 231 253 227 260 0.84

10 11 0.55 6.9e+02 1.9 0.2 21 44 277 300 272 304 0.85

11 11 0.00032 0.41 12.3 0.2 21 48 305 331 302 335 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.00026	0.33	12.6	0.1	21	47	6	32	3	39	0.84
2	11	1.2	1.5e+03	0.9	0.1	23	52	36	65	32	68	0.86
3	11	0.5	6.3e+02	2.0	0.2	21	44	62	85	50	90	0.87
4	11	0.16	2e+02	3.7	0.1	21	44	90	113	87	121	0.86
5	11	0.0023	2.9	9.5	0.1	21	44	118	141	114	150	0.86
6	11	0.63	7.9e+02	1.7	0.1	23	52	148	176	146	178	0.85
7	11	3.3	4.2e+03	-0.6	0.0	21	43	173	195	169	199	0.72
8	11	0.081	1e+02	4.6	0.2	13	44	193	224	185	232	0.83
9	11	0.76	9.6e+02	1.5	0.0	23	45	231	253	227	260	0.84
10	11	0.55	6.9e+02	1.9	0.2	21	44	277	300	272	304	0.85
11	11	0.00032	0.41	12.3	0.2	21	48	305	331	302	335	0.87

Coding Sequence: ATGTTGACACACACCGGAGAAAAACCGTTCggttgtgacgtttgcggttgCAAATTCCGACAGTCCAGCCATTTAAGGCAGCACATGTTCACGCACACCGGCAAGAAGCCATACGTCTGTGGCCTCTGCGATCAGAAGTATCGATCTCCCGGAGAACTGAAACAACACATGTTGATACACACCAGCacgaagccgttcagttgtgaactTTGCGATTACAGTTGCCGAGAGCGCAGACTGTTGAATTATCATATGCTGATGCACACCGGCGAGAacccgttcagttgtgacctttgcgattataaatgtcggctgcattcatctttgaaacggcacatgttaacgcacaccgATGAGAAACCCTTCAGTTGTGATCTGTGCGATGCCAAATTCAAACAAGCCTGCCGGTTGAAGCGACAcaagttaatacacaccggctTGAAACCTTTTAGCTGTGACCTGTGCGATTTCAGTTGCCGAGAACGTCGAGTTTTAAACTATCACATGTTGGTACACACCGAGAAGCCATTCGCTTGCGATTTTTGCGTTTACAAGGGGCGATCTCGCGATGAGTTGGAAAAACACCATGCGGTACACGCCGATGAGAAGCCGTTTAggtgtgatctttgcgattacatcTGCCGAGATCAGAAGCGTTTGAGCGAGCATGTGCTAACGCACACCGGCGGGAAGCCtctcagttgtgacctttgcgatttcGTATGTCGTGAACCCTCTGATATGAAAGAGCACAGCTCAATTCACACCGTTGGGAAAGCTAACGGTTGCAGTCGCTGCCTACAAAGCACAGTTTTGTCGACGGACACCGACGAGAGGTCGTTCGCTTGTGATCTTTGCCAGTGCAGGTTCAGACAGGCGGGTCCTTTGAAGTACCACATGTTAACGCATACCGGTGAGAAACCGTCCAGTTGCAATATGTGTGATTACAAGTGCCGATCTAGCCGAGATTTGAAAAAACACGTGTCGAGACACGCCGGCAAAACGCAGAAGACATTGAGTTTCGATTACTACTGCGATCAAATTAAGCATTTGGAATAA
Protein Sequence: MLTHTGEKPFGCDVCGCKFRQSSHLRQHMFTHTGKKPYVCGLCDQKYRSPGELKQHMLIHTSTKPFSCELCDYSCRERRLLNYHMLMHTGENPFSCDLCDYKCRLHSSLKRHMLTHTDEKPFSCDLCDAKFKQACRLKRHKLIHTGLKPFSCDLCDFSCRERRVLNYHMLVHTEKPFACDFCVYKGRSRDELEKHHAVHADEKPFRCDLCDYICRDQKRLSEHVLTHTGGKPLSCDLCDFVCREPSDMKEHSSIHTVGKANGCSRCLQSTVLSTDTDERSFACDLCQCRFRQAGPLKYHMLTHTGEKPSSCNMCDYKCRSSRDLKKHVSRHAGKTQKTLSFDYYCDQIKHLE

Sequence clustering based on sequence similarity using MMseqs2