Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.33 4.2e+02 2.6 0.3 21 45 6 30 4 37 0.78

2 8 0.00021 0.26 12.9 0.1 22 48 35 60 31 66 0.87

3 8 0.5 6.3e+02 2.0 0.1 22 44 64 86 59 92 0.86

4 8 0.0065 8.1 8.1 0.1 22 47 93 118 88 123 0.80

5 8 0.52 6.5e+02 2.0 0.0 21 44 120 143 118 147 0.87

6 8 0.032 40 5.9 0.1 21 44 148 171 145 175 0.91

7 8 0.3 3.8e+02 2.7 0.1 18 44 174 200 171 205 0.77

8 8 0.0056 7 8.3 0.2 21 48 205 232 201 237 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.33	4.2e+02	2.6	0.3	21	45	6	30	4	37	0.78
2	8	0.00021	0.26	12.9	0.1	22	48	35	60	31	66	0.87
3	8	0.5	6.3e+02	2.0	0.1	22	44	64	86	59	92	0.86
4	8	0.0065	8.1	8.1	0.1	22	47	93	118	88	123	0.80
5	8	0.52	6.5e+02	2.0	0.0	21	44	120	143	118	147	0.87
6	8	0.032	40	5.9	0.1	21	44	148	171	145	175	0.91
7	8	0.3	3.8e+02	2.7	0.1	18	44	174	200	171	205	0.77
8	8	0.0056	7	8.3	0.2	21	48	205	232	201	237	0.83

Coding Sequence: ATGTTggcgcacaccggcgagaaacccaTCACTTGCGACCAGTGCGATTACAAATGCACACGGCTCAGGTATCTGAAGGCGCACgtgttaatacacaccggcgacAAGCCGTTCAGCTGCGACGTCTGCGATTACAAGACCCGAATATCCGCGAACCTGAGGAGGCACATGTTGAAACACGCCGGCAacaagaagccgttcagttgcgacgcttgtgattacaaatgccgatTATCCGGAAGCCTCGGAAGGCACGTGCTGAAACACACCCGCGACGAGAAGCTCTTCATTTGCGCCGTTTGTGATTACAAATGTCGATTATCTGGGAATCTGAAGCGACACATGCTAAtacacacgggcgagaagccgtacagttgcgatctttgcgattacaagggTCGACAACTTGGGAAGTTGAAGGCGCACATGTTAACGCACTCCGGCGAGAAGCCGCTCAGCTGCGACCTTTGCGGATACAAATGCCGGCAGCTTCAGTATTTCAAACGCCACATGGCGGCGCACAGCGGCGacgaaaagccgttcagttgtgatcgtTGCGGTTATAAATGTCAACGACAGGGAATGTTGAAGCGACACgtgttaaagcacaccgacgagaagccgatTAGTTGTAGTATTTGCGATTATAGTTGCCAAAAACGTATGGAGTTGAAACGGCACATGTTGATACACGCCGACGGGAAACCTGTCAGTTCCGATCCTGGCGGGTAG
Protein Sequence: MLAHTGEKPITCDQCDYKCTRLRYLKAHVLIHTGDKPFSCDVCDYKTRISANLRRHMLKHAGNKKPFSCDACDYKCRLSGSLGRHVLKHTRDEKLFICAVCDYKCRLSGNLKRHMLIHTGEKPYSCDLCDYKGRQLGKLKAHMLTHSGEKPLSCDLCGYKCRQLQYFKRHMAAHSGDEKPFSCDRCGYKCQRQGMLKRHVLKHTDEKPISCSICDYSCQKRMELKRHMLIHADGKPVSSDPGG

Sequence clustering based on sequence similarity using MMseqs2