Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.0056 7 8.3 0.1 22 45 7 30 4 39 0.86

2 11 3.7 4.7e+03 -0.7 0.2 22 44 35 57 32 61 0.73

3 11 4.7e-05 0.059 14.9 0.2 14 44 55 85 45 90 0.83

4 11 0.026 33 6.1 0.0 21 43 90 112 86 122 0.87

5 11 1.6 2.1e+03 0.4 0.1 21 43 118 140 113 142 0.80

6 11 0.2 2.5e+02 3.3 0.2 20 45 145 170 139 179 0.80

7 11 6.6 8.3e+03 -1.6 0.0 22 39 175 192 172 203 0.64

8 11 0.92 1.2e+03 1.2 0.2 21 42 202 223 196 228 0.73

9 11 0.12 1.5e+02 4.0 0.2 21 42 230 253 227 258 0.71

10 11 0.00074 0.93 11.1 1.1 19 44 256 281 252 286 0.86

11 11 0.0073 9.2 7.9 0.0 21 43 286 308 283 313 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.0056	7	8.3	0.1	22	45	7	30	4	39	0.86
2	11	3.7	4.7e+03	-0.7	0.2	22	44	35	57	32	61	0.73
3	11	4.7e-05	0.059	14.9	0.2	14	44	55	85	45	90	0.83
4	11	0.026	33	6.1	0.0	21	43	90	112	86	122	0.87
5	11	1.6	2.1e+03	0.4	0.1	21	43	118	140	113	142	0.80
6	11	0.2	2.5e+02	3.3	0.2	20	45	145	170	139	179	0.80
7	11	6.6	8.3e+03	-1.6	0.0	22	39	175	192	172	203	0.64
8	11	0.92	1.2e+03	1.2	0.2	21	42	202	223	196	228	0.73
9	11	0.12	1.5e+02	4.0	0.2	21	42	230	253	227	258	0.71
10	11	0.00074	0.93	11.1	1.1	19	44	256	281	252	286	0.86
11	11	0.0073	9.2	7.9	0.0	21	43	286	308	283	313	0.92

Coding Sequence: ATGTTAGTGCACACCGATGAAAAGCCTTTTCGCTGCGCCACCTGCGATCGCAAATTTCTACAATCGAAAGATTTAAAAAGGCACATGCTAACGCACACccgcgagaaaccgttcagttgcgaCCTCTGCGAGTACAAGTGCGGACGGGCCCACCATCTGGAACAACACATGTCGATACACAGCGAAGAGAAGCCCTTTCGTTGCGTCGTCTGCGATTTCCAATTTCGACAATCCAAGGATTTAAAAAggcacatgttaacgcacaccggcgagaaacccttcggttgtgacctttgcgactACAAGGGCAGACAGTCCCATCATTTGAAGCAGCACAGGCTAACGCACTCCGGCGAGAAGCCTTACTCCTGCGATCTTTGCGAATACAAGTGTCGATACGTCGGAAACTTGATAGATCACAAGTCAACGCACAGCGGCGAGAAGCAGTTTCAATGTGGAACCTGCGATTTTAAGTGCCGGCTTAAGAGACGTCTGAAACGACACATGTACACGCACACGGACGAGAAACCGCTCAGTTGCGATTTTTGCGACTACAAATGTTGGGAAAGAAGACGTTTGGATCTGCAtcagttaaaacacaccggcgagagaCCGTTCGGTTGTGAGATTTGCGGTTACAAATGCGCACGTGCGTCTAGCTTGAAGCAACACGGGTTgatacataccggcgagaaacctCTGGCTTGTGATatctgcgattacaaatgtcgagaGAGAAGGTCTTGGAACCTGCATaggttaaagcacaccggcgaacAGCCGTCTTGTTGCGGAATTTGCAATTACAGATGCGTAGATGAGAAAACCTTGCGACGGCATATGTTGACGCACCCCGGCGAACAACCGTTCgcttgcgatctttgcgattacaaatgcagACATGCCGGAAACTTGAAGAAACACAAGTCAACACATCAGCGAGAAGCTGTTTGA
Protein Sequence: MLVHTDEKPFRCATCDRKFLQSKDLKRHMLTHTREKPFSCDLCEYKCGRAHHLEQHMSIHSEEKPFRCVVCDFQFRQSKDLKRHMLTHTGEKPFGCDLCDYKGRQSHHLKQHRLTHSGEKPYSCDLCEYKCRYVGNLIDHKSTHSGEKQFQCGTCDFKCRLKRRLKRHMYTHTDEKPLSCDFCDYKCWERRRLDLHQLKHTGERPFGCEICGYKCARASSLKQHGLIHTGEKPLACDICDYKCRERRSWNLHRLKHTGEQPSCCGICNYRCVDEKTLRRHMLTHPGEQPFACDLCDYKCRHAGNLKKHKSTHQREAV

Sequence clustering based on sequence similarity using MMseqs2