Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.081 1e+02 4.6 0.0 21 46 10 34 5 40 0.87

2 8 1.2 1.5e+03 0.8 0.0 22 49 60 86 53 96 0.78

3 8 2.4 3e+03 -0.1 0.1 22 44 116 138 112 146 0.80

4 8 0.11 1.4e+02 4.1 0.0 23 43 145 165 141 171 0.89

5 8 0.05 63 5.2 0.0 21 45 171 195 166 202 0.90

6 8 0.0066 8.3 8.1 0.1 20 52 204 236 199 237 0.89

7 8 0.00028 0.35 12.4 0.1 23 44 235 256 231 260 0.89

8 8 0.0017 2.2 9.9 0.2 21 48 261 288 258 289 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.081	1e+02	4.6	0.0	21	46	10	34	5	40	0.87
2	8	1.2	1.5e+03	0.8	0.0	22	49	60	86	53	96	0.78
3	8	2.4	3e+03	-0.1	0.1	22	44	116	138	112	146	0.80
4	8	0.11	1.4e+02	4.1	0.0	23	43	145	165	141	171	0.89
5	8	0.05	63	5.2	0.0	21	45	171	195	166	202	0.90
6	8	0.0066	8.3	8.1	0.1	20	52	204	236	199	237	0.89
7	8	0.00028	0.35	12.4	0.1	23	44	235	256	231	260	0.89
8	8	0.0017	2.2	9.9	0.2	21	48	261	288	258	289	0.94

Coding Sequence: atgaaacggcacaagttcatacacaccggcgagaaaccgtatAGTTGCGGCCTTTGCCTTTATACTACCGGAACGAGTAGCACCTTGAAAAAGCACTTGTTAACACACACCAAGAAAGAAACCTCGAGTTGCGATCGGAAGCGTCGACTTAGCGCAGATTTATCGAATAAAGCCGACGAGAAGTTGTTCACTtgcggtctttgcgattacgaaGGGCGAGATCGCAACCAGTTGAATCAGCATATATTAATACACTTTGACAGGAAACCTTTGAGTTGTGATGCTTGCGATTTCAAATGCCGAGATGATatcgttttaaaaaatcacaagTTAGCTCACACCGTCGAGGCACCGTTGAGTTGCggcctttgcgattataagtgccgactGCGCACggttttgaaacagcacatgctGACACACACCGACGTTAAGCCGTTCAGTTGCAACCTTTGCGATTCCAAATTCAGGCAGAAAGGTCACCTGAGAGTCCACAAGTTaatacataccggcgagaagccacACAGTTGCGGCTTATGCGATCACAAGTCTCGATCTGGCGGAGACTTGAAGAAACACATGGAAAGCCACCTTGACAAAAAATACCGAAACGCTGAAAAAACGGCCAGTTGCGGTCTTTGCGATTTGAAGTTCAAAAGATTGACGCATTTAAGACGGCACATGTTGACACACACCAACGCAAAGCCGTACAGTTGCGAGATTTGCCATTCCGCGTTCAGACAGTCTGGTCACTTGAAGCAGCATATGttgatacacaccggcgagaagccgttcagttgtgattcttgcgattacaagtgccgatCTAACGGAGACTTGAGAAGGCACGTCAAAGCACgccattcttaa
Protein Sequence: MKRHKFIHTGEKPYSCGLCLYTTGTSSTLKKHLLTHTKKETSSCDRKRRLSADLSNKADEKLFTCGLCDYEGRDRNQLNQHILIHFDRKPLSCDACDFKCRDDIVLKNHKLAHTVEAPLSCGLCDYKCRLRTVLKQHMLTHTDVKPFSCNLCDSKFRQKGHLRVHKLIHTGEKPHSCGLCDHKSRSGGDLKKHMESHLDKKYRNAEKTASCGLCDLKFKRLTHLRRHMLTHTNAKPYSCEICHSAFRQSGHLKQHMLIHTGEKPFSCDSCDYKCRSNGDLRRHVKARHS

Sequence clustering based on sequence similarity using MMseqs2