Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.0018 2.3 9.9 0.0 21 47 6 31 4 37 0.89

2 8 3 3.8e+03 -0.5 0.2 23 43 37 57 32 63 0.84

3 8 0.032 41 5.9 0.3 16 45 58 87 47 93 0.80

4 8 0.068 86 4.8 0.0 22 44 93 115 90 120 0.90

5 8 0.17 2.2e+02 3.5 0.0 21 46 121 146 117 152 0.84

6 8 0.0033 4.1 9.0 0.0 21 49 149 176 146 178 0.90

7 8 0.0069 8.7 8.0 0.0 21 44 178 201 176 206 0.91

8 8 0.0056 7 8.3 0.0 21 48 206 232 203 237 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.0018	2.3	9.9	0.0	21	47	6	31	4	37	0.89
2	8	3	3.8e+03	-0.5	0.2	23	43	37	57	32	63	0.84
3	8	0.032	41	5.9	0.3	16	45	58	87	47	93	0.80
4	8	0.068	86	4.8	0.0	22	44	93	115	90	120	0.90
5	8	0.17	2.2e+02	3.5	0.0	21	46	121	146	117	152	0.84
6	8	0.0033	4.1	9.0	0.0	21	49	149	176	146	178	0.90
7	8	0.0069	8.7	8.0	0.0	21	44	178	201	176	206	0.91
8	8	0.0056	7	8.3	0.0	21	48	206	232	203	237	0.86

Coding Sequence: ATGATGATACATAcaggcgagaaaccgttcagttgtgacctctgCGATTACCAGTCCCGAATATCGGGAAATTTAAAACGGCACATACTAAAGCACACCGGTGGCAAGAGGCCGTTCAGCTGTGATCGTTGCGATTACACGTGTCGAGAGCCCGGAAGCTTGAGGCAGCACAGGTTGacacataccggcgagaagccgatcagttgcgatctttgcggtTACAAGTGCCGAGACGCGGTGCAATTGAAGCAGCACATGTCGACGCACTTCGTCGGAGAGAAGCCTTTCCGGTGTGACATTTGCGATTACAGGTTCCAACTGTTCGGAAATTTAAAGCGGCACATGGTTAAGCACACCGGCGGCGAGAGGCCGTTCAGCTGCGacttttgcgattacaagtgccgacACCCTTGGAATTTGAAGCTGCACATGttgatacacaccggcgagaagccgttcggttgtgatctttgcgattacaagtgtcggGAATCGGGAAAATTGAAGCGGCACGTGTTGACGCACTTCGATGGggagaagccgttcagctgcgaccattgcgattacaagtgtcgaCAATCCGGAAGCATGAAGCGGCACATGCtgacgcacaccggcgagaaaccgttcagttgtgagtTTTGCAGTTACAAATTCCGACAGTCCGGGCATTTAAATAAGCACATGTTGACGCATACGGTCAAGAATACTTCAAGTGCAAATATCAAGCTTGAGCAAGATTTTTAA
Protein Sequence: MMIHTGEKPFSCDLCDYQSRISGNLKRHILKHTGGKRPFSCDRCDYTCREPGSLRQHRLTHTGEKPISCDLCGYKCRDAVQLKQHMSTHFVGEKPFRCDICDYRFQLFGNLKRHMVKHTGGERPFSCDFCDYKCRHPWNLKLHMLIHTGEKPFGCDLCDYKCRESGKLKRHVLTHFDGEKPFSCDHCDYKCRQSGSMKRHMLTHTGEKPFSCEFCSYKFRQSGHLNKHMLTHTVKNTSSANIKLEQDF

Sequence clustering based on sequence similarity using MMseqs2