Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00014 0.18 13.4 0.0 18 44 7 33 2 38 0.89

2 6 1.3e-06 0.0017 19.9 0.2 21 44 38 61 34 67 0.90

3 6 5.7 7.2e+03 -1.4 0.1 21 37 66 82 63 92 0.69

4 6 1.4e-06 0.0018 19.8 0.0 20 45 93 118 85 125 0.88

5 6 0.2 2.5e+02 3.3 0.0 21 43 122 144 119 153 0.83

6 6 0.0048 6 8.5 0.0 23 45 152 174 146 178 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00014	0.18	13.4	0.0	18	44	7	33	2	38	0.89
2	6	1.3e-06	0.0017	19.9	0.2	21	44	38	61	34	67	0.90
3	6	5.7	7.2e+03	-1.4	0.1	21	37	66	82	63	92	0.69
4	6	1.4e-06	0.0018	19.8	0.0	20	45	93	118	85	125	0.88
5	6	0.2	2.5e+02	3.3	0.0	21	43	122	144	119	153	0.83
6	6	0.0048	6	8.5	0.0	23	45	152	174	146	178	0.88

Coding Sequence: ATGAAGAATCACAAATTAAGACATACCAATGAGAAACCGTTCACTTGTGAAATTTGCGATCGCAATTTTAAACAACGTGGAACCTTGAAGCGGCACGTGTTAACGCACAACAAAGAAAAGCCCTTCACTTGTGGAATTTGCGATCGTAATTACAGACAACTTAGAAACTTGAAACGGCACGCGTTAACGCACAACAAAGAGGAGCCCTTCGCTTGTAAAACTTGCGATTGTAAATTCAAACGATTCGCAATCTTGGAACagcacatgttaacgcacaACACAGAGAAGCCCTTCACTTGTAAAATTTGCCAACGTGGATTCACACAAACGAAAAACTTGAAACGCCATTTATtaacacacaccgacgagaagcctttcagttgcgatctttgcgattacaagtgtcgaCGATCCGACGGGATGAAGGAACACAAATTAAGTCATACCAACGTGAAGCCCTTCACTTGTAAAATTTGCGATCGTGGATACACACAAATGGGAACATTGAAACGCCACTTGTTAAACACACACAAGTGA
Protein Sequence: MKNHKLRHTNEKPFTCEICDRNFKQRGTLKRHVLTHNKEKPFTCGICDRNYRQLRNLKRHALTHNKEEPFACKTCDCKFKRFAILEQHMLTHNTEKPFTCKICQRGFTQTKNLKRHLLTHTDEKPFSCDLCDYKCRRSDGMKEHKLSHTNVKPFTCKICDRGYTQMGTLKRHLLNTHK

Sequence clustering based on sequence similarity using MMseqs2