Dpar001100.1
Basic Information
- Insect
- Dorcus parallelipipedus
- Gene Symbol
- -
- Assembly
- GCA_958336345.1
- Location
- OY284475.1:8455356-8456432[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 12 0.13 12 8.0 2.3 2 23 19 40 18 40 0.96 2 12 0.014 1.3 11.1 1.8 1 23 46 68 46 68 0.98 3 12 0.00013 0.012 17.4 2.1 1 23 74 96 74 96 0.99 4 12 0.00048 0.044 15.7 3.8 3 23 104 124 104 124 0.98 5 12 0.006 0.55 12.2 4.3 2 23 132 153 131 153 0.96 6 12 0.19 18 7.5 7.1 1 23 159 181 159 181 0.97 7 12 2.4e-05 0.0022 19.8 0.2 1 23 187 209 187 209 0.98 8 12 0.0045 0.41 12.6 5.2 1 23 215 237 215 237 0.98 9 12 0.056 5.2 9.2 0.7 1 23 246 268 246 268 0.93 10 12 0.0005 0.046 15.6 0.7 1 23 274 296 274 296 0.97 11 12 1.9e-05 0.0018 20.1 4.7 1 23 302 324 302 324 0.97 12 12 0.0022 0.2 13.6 2.2 1 23 330 352 330 352 0.93
Sequence Information
- Coding Sequence
- ATGCGCGGACATCTGAAGCTGCACATGTTAAGGCACAGCAACGAGCAACTGCTCAGGTGTACTCTTTGCAATTTCAAGTGCAGGGCAGCCAAAAAATTGGAAGCGCACGTGTCAAAGCACGGCAGTGCGAAGTGGTTCAGTTGCAATCTCTGCGAATACAAATCCCAATTTACCGTAGATTTAAGGCGACACATGTTGAAGCACaacgacgagaaaccgttcaaaTGTGACCTTTGCGGTTACAGCTGTCGAAGTGCGGGGAGATTGAGGGAGCATAGGTTAACACACACCGTTGAGAAACCAGTCGGTTGTAAACTTTGCGATTATACGTGCCGAAGGCGTGAggatttgaaacagcacatgttTATACACACCGACCCCGAAAAGTGGTTGAGCTGTGacgtttgcgattataagtgtcCACGTTCCAGCACTATGAACCAtcacaaattaacacacactGGCGAGATGCGGTTCAGTTGTAGCCATTGCGAATACAAATGCCTACAGCGATTCCAACTGAAGCGGCACGTGTTAACACACAGcagcgagaagccgttcacttgCGTAATTTGCGATCGTAAAGTGAAAGAACTCGGAAATTTGAAGCGCCACATGTTgatacacaccggcgaaaagccgttcagctgcgatctttgcgattacaagtgtcgaTTCGCCACGTATTTAAAGAAACATAAATTGACACATTCTAGTGACGGCGCCGAGAAGCCGTTCGCTTGTAACAGTTGTAGTTACAAAAGCCTGACTCTCCGGAATTTAACTCGGCACATGGCAGtgcataccggcgagaagcggTTCAgctgtgacctttgcgattataaatcgCGAAGAAATGGAGATCTGAAAGACCATAAGTTAATACATACTGGTGAAAAACCGTTTGCTTGTGGcgtttgcgattacaagtgccggCACCGTTCAAATTTGAGACAGCACATGTTAACTCACCAGAGCCAGAAATCGTTTACCTGTGGAATCTGCGATTTCACAGCCCGACGACACTCAAGCTTGAAAAGACATGACATGACCCACCGACAGAAAACTTCGTTGTAA
- Protein Sequence
- MRGHLKLHMLRHSNEQLLRCTLCNFKCRAAKKLEAHVSKHGSAKWFSCNLCEYKSQFTVDLRRHMLKHNDEKPFKCDLCGYSCRSAGRLREHRLTHTVEKPVGCKLCDYTCRRREDLKQHMFIHTDPEKWLSCDVCDYKCPRSSTMNHHKLTHTGEMRFSCSHCEYKCLQRFQLKRHVLTHSSEKPFTCVICDRKVKELGNLKRHMLIHTGEKPFSCDLCDYKCRFATYLKKHKLTHSSDGAEKPFACNSCSYKSLTLRNLTRHMAVHTGEKRFSCDLCDYKSRRNGDLKDHKLIHTGEKPFACGVCDYKCRHRSNLRQHMLTHQSQKSFTCGICDFTARRHSSLKRHDMTHRQKTSL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00467129;
- 90% Identity
- iTF_00467129;
- 80% Identity
- iTF_00467129;