Basic Information

Insect: Dorcus parallelipipedus
Gene Symbol: -
Assembly: GCA_958336345.1
Location: OY284475.1:7887033-7888361[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 15 0.17 16 7.6 0.3 6 23 2 19 1 19 0.96

2 15 0.00027 0.025 16.5 1.2 2 23 26 47 25 47 0.97

3 15 0.021 1.9 10.5 3.2 2 23 79 100 78 100 0.96

4 15 0.00046 0.043 15.7 5.6 1 23 106 128 106 128 0.98

5 15 1.6e-05 0.0015 20.3 3.7 3 23 136 156 134 156 0.98

6 15 3.5e-05 0.0032 19.2 2.9 1 23 162 184 162 184 0.98

7 15 0.15 14 7.8 1.9 3 23 192 212 190 212 0.97

8 15 0.022 2.1 10.4 0.2 3 23 220 240 218 240 0.94

9 15 8e-05 0.0074 18.1 3.8 1 23 246 268 246 268 0.98

10 15 0.043 4 9.5 7.0 2 23 275 296 274 296 0.96

11 15 0.0033 0.31 13.0 6.6 3 23 304 324 304 324 0.99

12 15 0.00011 0.01 17.7 7.9 1 23 330 352 330 352 0.98

13 15 4e-05 0.0037 19.1 3.8 1 23 358 380 358 380 0.98

14 15 0.081 7.5 8.6 2.2 1 23 385 407 385 407 0.97

15 15 0.0047 0.44 12.5 4.7 2 23 414 436 413 436 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	15	0.17	16	7.6	0.3	6	23	2	19	1	19	0.96
2	15	0.00027	0.025	16.5	1.2	2	23	26	47	25	47	0.97
3	15	0.021	1.9	10.5	3.2	2	23	79	100	78	100	0.96
4	15	0.00046	0.043	15.7	5.6	1	23	106	128	106	128	0.98
5	15	1.6e-05	0.0015	20.3	3.7	3	23	136	156	134	156	0.98
6	15	3.5e-05	0.0032	19.2	2.9	1	23	162	184	162	184	0.98
7	15	0.15	14	7.8	1.9	3	23	192	212	190	212	0.97
8	15	0.022	2.1	10.4	0.2	3	23	220	240	218	240	0.94
9	15	8e-05	0.0074	18.1	3.8	1	23	246	268	246	268	0.98
10	15	0.043	4	9.5	7.0	2	23	275	296	274	296	0.96
11	15	0.0033	0.31	13.0	6.6	3	23	304	324	304	324	0.99
12	15	0.00011	0.01	17.7	7.9	1	23	330	352	330	352	0.98
13	15	4e-05	0.0037	19.1	3.8	1	23	358	380	358	380	0.98
14	15	0.081	7.5	8.6	2.2	1	23	385	407	385	407	0.97
15	15	0.0047	0.44	12.5	4.7	2	23	414	436	413	436	0.94

Sequence Information

Coding Sequence: ATGTGCGACTCGAAATTTAAATCTTACGAATGGATACGCAAGCACATACTGACGCATACCGGCGAGGTGTTACTCAGATGTgtcctttgcgattacaaatgccgaaaTCCCGACGGCTTAAGACTGCACATGTCGACGCACACCGACGAGATGTTCATACGTTATCCTTGCAGCGTCCAACTTCCCCCCAACTCGAAGGACGACATGTTAGTATACACTGTAGTGAAGCTGTCCAGCTGCGATAGCTGCGACTACAAGTGCCGAGATTCCAGCAGTATGAAGCAGCACAAGttgatacacaccggcgagaagccctTCAGCTGTGACCtgtgcgattacaagtgccgacAAAACACGACCCTAAAACATCACATGTTAGTACACACGGGAGAAaaaccgttcggttgtgataTTTGCGGATGCAAGTTCAGACAATCCGGGCATTTGAAGCTGCACATGTTGACGCACACCGgggagaagccattcagttgtgaatTTTGCGATCAGAAGTGTCGGTCCCGCGGtgatttgaaacggcacatgttGGTGCACACCCATGAGAAGCCGTTTGGTTGTGATTtctgcgattacaagtgccgagAACGCAGGCTACTGAATTACCACGTGTTAATACATGCCGGCGAGAAATCATTCGGCTGCGATTTTTGCGATTACAAGGGTCGCTCGCGCGGAGATTTGAAGCGACACGCGGTAGTACACGCCGAcaagaagccgtttagttgtgacctttgcgactACAACTGCCGAGACCGCAGGCAGTTGAAACAGCACATGctaacgcacaccggcgagaagccgctcAGCTGTGGTTTCTGTGATCACAAATGTCGAGATCCCTGCAGCATGAGGCGGCACATGCTGACGCACACTGACGAGAGACCGATCGGCTGtagtctttgcgattataagtgtcgACAACACTCGACTTTGAGGCagcacatgttaacgcacaccaacgaaaagccgttcagttgtaagCTTTGCGATTGCAAATTTAGACAGTCCGGTCATTTGAAGCATCACATGttgatacacaccggcgagaagccgttcagttgtgacctctgcgattataagtgccgtaCTAACGGAGACTTGAAAAAGCACATGTCAAGACACTCCAACAAGCCGTTTAGTTGCGATTCTTGCGATTATAGTTGTCTGGAACGCGGACAGTTGAAACAGCATATGTTACAACAcgccggcgagaaaccgttgaGTTGCggcctttgcgattataagtgccgacagATCAaacatttgaaacggcacatgcTTAACAGTCATGTCAATGACGAGAGCCAATAA
Protein Sequence: MCDSKFKSYEWIRKHILTHTGEVLLRCVLCDYKCRNPDGLRLHMSTHTDEMFIRYPCSVQLPPNSKDDMLVYTVVKLSSCDSCDYKCRDSSSMKQHKLIHTGEKPFSCDLCDYKCRQNTTLKHHMLVHTGEKPFGCDICGCKFRQSGHLKLHMLTHTGEKPFSCEFCDQKCRSRGDLKRHMLVHTHEKPFGCDFCDYKCRERRLLNYHVLIHAGEKSFGCDFCDYKGRSRGDLKRHAVVHADKKPFSCDLCDYNCRDRRQLKQHMLTHTGEKPLSCGFCDHKCRDPCSMRRHMLTHTDERPIGCSLCDYKCRQHSTLRQHMLTHTNEKPFSCKLCDCKFRQSGHLKHHMLIHTGEKPFSCDLCDYKCRTNGDLKKHMSRHSNKPFSCDSCDYSCLERGQLKQHMLQHAGEKPLSCGLCDYKCRQIKHLKRHMLNSHVNDESQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00467107;
90% Identity: iTF_00467107;
80% Identity: iTF_00467107;