Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.17 2.4e+02 3.5 0.1 21 48 10 36 7 38 0.89

2 7 0.00019 0.26 12.9 0.0 18 45 35 62 30 69 0.86

3 7 0.023 32 6.2 0.0 22 51 67 96 64 97 0.83

4 7 0.039 55 5.5 0.0 23 48 96 121 92 126 0.83

5 7 0.33 4.5e+02 2.6 0.3 22 48 123 148 120 152 0.83

6 7 0.58 8e+02 1.8 0.1 17 52 196 231 180 233 0.70

7 7 0.072 99 4.7 0.1 22 45 229 252 225 257 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.17	2.4e+02	3.5	0.1	21	48	10	36	7	38	0.89
2	7	0.00019	0.26	12.9	0.0	18	45	35	62	30	69	0.86
3	7	0.023	32	6.2	0.0	22	51	67	96	64	97	0.83
4	7	0.039	55	5.5	0.0	23	48	96	121	92	126	0.83
5	7	0.33	4.5e+02	2.6	0.3	22	48	123	148	120	152	0.83
6	7	0.58	8e+02	1.8	0.1	17	52	196	231	180	233	0.70
7	7	0.072	99	4.7	0.1	22	45	229	252	225	257	0.88

Coding Sequence: ATGAAGCGTCACCTGTtaacgcacaccggcgagaaaccgttcgctTGCACCTTCTGCGACTTTACCTGCCGATCGAATACGACTTTGAAAAATCACACGCTGAGACACACCGGAGAGAAGCCGTTCAAGTGTGGCGTTTGCGGTCGGAGATTCAGGCAGTCCGGTAATTTGAAGCAGCACACGCTCATACACACCGGCGATAAGCCGTACCTTTGTGAAATTTGCGACCACAAGTTTCGATCTTCTAAAGAACTGAAATGGCATACGTTAATACACACCAACTCGAAGCCGTTCGCTTGTGGTGTTTGCGACGGAAAGTTCAGGCAGAAGAGTCACTTGAAGTACCACATGTTGATACACACCGGTCAGAAACCACACGGTTGTAATAAATGCGATTATAGCTGCCGGTCTACCAGCGATTTAAAAAGACACAAGTTGCAACACACCAAGAAACAGTTGTGTTGTTTGCTTTGCGATTACATCTGCCTAAAGCGCGGACAGTTGAAACAGCACATGTTGACACATGATTCCGAGGAACCAATTAATCGTAGTAAATCCCGATCTGGCGGCGATTTAAAGAGACATGTGTCGACACGCGCCGAGGAACTGTTGAGTTGTTTTCTTTGTGATTTCATTTGCCCAGAACGCGGACAGTTGAAGCAGCACATGTTGACACACGATTTCGAGAAACCATTGAGTTGCGAACTTTGCGGTTACAAGTGCCGACAAATTAATGACTTGAATCAGCACATGCTTAATACACATACAAATGTCACCTAA
Protein Sequence: MKRHLLTHTGEKPFACTFCDFTCRSNTTLKNHTLRHTGEKPFKCGVCGRRFRQSGNLKQHTLIHTGDKPYLCEICDHKFRSSKELKWHTLIHTNSKPFACGVCDGKFRQKSHLKYHMLIHTGQKPHGCNKCDYSCRSTSDLKRHKLQHTKKQLCCLLCDYICLKRGQLKQHMLTHDSEEPINRSKSRSGGDLKRHVSTRAEELLSCFLCDFICPERGQLKQHMLTHDFEKPLSCELCGYKCRQINDLNQHMLNTHTNVT

Sequence clustering based on sequence similarity using MMseqs2