Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00019 0.26 12.9 0.3 6 48 6 45 3 48 0.86

2 9 0.14 1.9e+02 3.8 0.2 18 44 44 70 43 78 0.85

3 9 0.028 39 6.0 0.3 22 48 76 101 72 103 0.91

4 9 0.016 22 6.7 0.2 18 48 100 129 98 134 0.84

5 9 0.29 4.1e+02 2.7 0.0 21 43 131 153 128 158 0.89

6 9 0.052 73 5.1 0.0 21 47 159 184 154 189 0.87

7 9 0.031 43 5.8 0.2 21 48 187 213 183 219 0.86

8 9 0.74 1e+03 1.4 0.8 21 44 229 252 226 256 0.80

9 9 0.024 34 6.2 0.0 21 48 257 284 254 290 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00019	0.26	12.9	0.3	6	48	6	45	3	48	0.86
2	9	0.14	1.9e+02	3.8	0.2	18	44	44	70	43	78	0.85
3	9	0.028	39	6.0	0.3	22	48	76	101	72	103	0.91
4	9	0.016	22	6.7	0.2	18	48	100	129	98	134	0.84
5	9	0.29	4.1e+02	2.7	0.0	21	43	131	153	128	158	0.89
6	9	0.052	73	5.1	0.0	21	47	159	184	154	189	0.87
7	9	0.031	43	5.8	0.2	21	48	187	213	183	219	0.86
8	9	0.74	1e+03	1.4	0.8	21	44	229	252	226	256	0.80
9	9	0.024	34	6.2	0.0	21	48	257	284	254	290	0.83

Coding Sequence: atgttaatacacaccgcTAAGAAGCCCAGCACGACTAAGAAGTCGTATAGTTGCGGTGAGAAACCCATCGGTTGCGAACTTTGCGATTACGGCTGCCTAAACTCCGCTCATTTAAAGCGACACATGCTGaggcacaccggtgagaaaccgTTCCGTTGCGAACTTTGCGACTTCAAGTGCCGAGATGCCTACGCTTTAGAACGACACACGCTGATACACatcgacgagaaaccgttcaacTGCGACGCTTGTGAATACACGTGCCGAGATACCACCAGCTTAAAACGGCACAAACTGAGACACTCCAGTGAGAACCCGTTCGGTTGCAAACTTTGCAAGTACAAGTGCTATCGTTACAGAGATTTGAAGCAGCACATGTTAAAGCATACTGGCGAGAAGCCGTACGGTTGTGACCTGTGCGATTTCAAATGCCGACAGCTCGGGCAACTGAAACAACACGCggtaaagcacaccggcgagaagccgatCAGTTgtaacctttgcgattataaatgcggaCAGCTCGGaaatttgaagcagcacatgttaaagcacacgggcgagaagccgttcagttgtgatctttgcagtTATAAATGCCGAGAGCTCAGACAGTTGAAGCAGCACACGTTGAAGCACAGCGGCGATAAGCCGTTCTTGAAACTGCATGAGCTGACGCGCGGTGCTGAGAAACCCATAAGCtgtagtctttgtgattacAGGTGCCGACTGCGCGCACATTTAAAACAGCACATGGTAACACACTCCGGTGAGaaaccgttcggttgtgatctttgcgattatgaGTGCCGATCCTTCGGAAATctgaagcggcacaagttagTACACAACGACGCGAAAAAGGaagttgattga
Protein Sequence: MLIHTAKKPSTTKKSYSCGEKPIGCELCDYGCLNSAHLKRHMLRHTGEKPFRCELCDFKCRDAYALERHTLIHIDEKPFNCDACEYTCRDTTSLKRHKLRHSSENPFGCKLCKYKCYRYRDLKQHMLKHTGEKPYGCDLCDFKCRQLGQLKQHAVKHTGEKPISCNLCDYKCGQLGNLKQHMLKHTGEKPFSCDLCSYKCRELRQLKQHTLKHSGDKPFLKLHELTRGAEKPISCSLCDYRCRLRAHLKQHMVTHSGEKPFGCDLCDYECRSFGNLKRHKLVHNDAKKEVD

Sequence clustering based on sequence similarity using MMseqs2