Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.065 90 4.8 0.9 20 44 20 44 4 54 0.83

2 7 0.00076 1.1 11.0 0.1 18 44 74 100 69 108 0.89

3 7 0.029 40 5.9 0.3 18 44 145 171 137 185 0.87

4 7 0.0068 9.4 8.0 0.1 21 48 204 230 197 231 0.90

5 7 0.0016 2.2 10.0 0.5 19 49 231 260 229 265 0.88

6 7 0.2 2.7e+02 3.3 0.2 20 50 260 289 257 291 0.84

7 7 0.035 48 5.7 0.1 16 44 284 312 280 316 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.065	90	4.8	0.9	20	44	20	44	4	54	0.83
2	7	0.00076	1.1	11.0	0.1	18	44	74	100	69	108	0.89
3	7	0.029	40	5.9	0.3	18	44	145	171	137	185	0.87
4	7	0.0068	9.4	8.0	0.1	21	48	204	230	197	231	0.90
5	7	0.0016	2.2	10.0	0.5	19	49	231	260	229	265	0.88
6	7	0.2	2.7e+02	3.3	0.2	20	50	260	289	257	291	0.84
7	7	0.035	48	5.7	0.1	16	44	284	312	280	316	0.86

Coding Sequence: atgtgtgattctaaatttaaatctcgatCGAATTTGAAGCGGCACGAGTCGATACATACCGACGAGAACCCGTTCGCTTGCGATCGCTGCAGTTCGAAATTTCGACGCGCTGCGTCTTTGAGGTCCCACATGCTGACGCACACCGGCCACAAGCCGTTTCTTTGCGGTCTTTGCGACTTCAAGTGTCGAAATTACGAGATGTTGAAGTGCCACATGACgaggcacaccggcgagaaaccctTCACTTGCGATGTCTGCGGTTATAAATGCCGATGGCTGCGAAATCTGAAAAATCACAgGTATCAGCGAAACCCTGAAGCCAAAACGGTGATTAAAAAAGGAAACTCTAAATTTACGTCCGGTGCATCTTTGCGAACTCATATTTCGATACATACCGATGACAAGTCGCTTAGTCGACGCCGGCACAAGTTAAGACAttccgacgagaagccgttcacttGCGACCTTTGCGATTTCAAATCCCGATATTACAGAGTTGTGAAAGCTCACTTGTTAACTCACACGGGCGAGAGGGCGTTCAGCTGTGACATTTGCGAATATAAAAGTCCGCGACGTGGATACTTGAAGgttcacaagttaaaacacaccggtgagaaaccgttcggttgtgagctttgcgattacaaatgccgacagcGCGGAgctttgaaacggcacaagctGAGGCACACACAAGGCGAGAAACCGTTTGCTTGTGGTCTTTGCTCTTACAGGGGGCGACAGGCGGAGCATTTGAAACAGCACGTGTTAAGACACTGCgttgagaagccgttcagttgtgatctttgcgattataaagggCGAGAGCTCAGGCTCTTGAAAGAGCACAGGTTGAGGCATTCAGACAAAGACCCGTTCGGTTGTGAGCTTTGCGATTTCAAATGCCGCGTTGCTAAAACTTTGAAAagacacatgttaaaacataaGTGA
Protein Sequence: MCDSKFKSRSNLKRHESIHTDENPFACDRCSSKFRRAASLRSHMLTHTGHKPFLCGLCDFKCRNYEMLKCHMTRHTGEKPFTCDVCGYKCRWLRNLKNHRYQRNPEAKTVIKKGNSKFTSGASLRTHISIHTDDKSLSRRRHKLRHSDEKPFTCDLCDFKSRYYRVVKAHLLTHTGERAFSCDICEYKSPRRGYLKVHKLKHTGEKPFGCELCDYKCRQRGALKRHKLRHTQGEKPFACGLCSYRGRQAEHLKQHVLRHCVEKPFSCDLCDYKGRELRLLKEHRLRHSDKDPFGCELCDFKCRVAKTLKRHMLKHK

Sequence clustering based on sequence similarity using MMseqs2