Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.00065 0.91 11.2 0.1 21 44 10 33 4 41 0.87

2 7 0.0044 6.1 8.6 0.0 21 43 66 88 59 96 0.90

3 7 0.017 23 6.7 0.9 17 45 118 146 111 153 0.84

4 7 0.0096 13 7.5 2.8 17 44 146 173 143 181 0.90

5 7 1.3 1.8e+03 0.7 0.0 21 47 178 204 175 209 0.83

6 7 0.039 55 5.5 0.0 21 46 206 231 197 235 0.81

7 7 0.23 3.2e+02 3.0 0.2 26 44 237 255 232 259 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.00065	0.91	11.2	0.1	21	44	10	33	4	41	0.87
2	7	0.0044	6.1	8.6	0.0	21	43	66	88	59	96	0.90
3	7	0.017	23	6.7	0.9	17	45	118	146	111	153	0.84
4	7	0.0096	13	7.5	2.8	17	44	146	173	143	181	0.90
5	7	1.3	1.8e+03	0.7	0.0	21	47	178	204	175	209	0.83
6	7	0.039	55	5.5	0.0	21	46	206	231	197	235	0.81
7	7	0.23	3.2e+02	3.0	0.2	26	44	237	255	232	259	0.88

Coding Sequence: ATGAGACAGCACATGAGGATCCATTCTAGCAGGAAACCTTTCGCCTGTCAGATTTGCAATAGTAAATTCCGGTTCGCCGGAAATTTGACGCGGCACATGTTAGTACACTCTGACAAGAAGCAGTTCGTTTGCGATCGCTGCGGTTACAAATGCCACGATGTTGGATCTTTGGTGCAGCACATGCGAATTCATACCGGTGAGagaccgttcagttgtgatctgtGCCCTCGGAAATTTCaacagtctggaaatttgaaaaagcacaagttGACACACGACGGCGAGAAGACGATCGGTTGTGAATTTTGCGATTACAAAGGTCGAAGTTTAGAAGATGTGAAACGCCACGCGAGAAGACATAGCAGCGAGAAACCGTTCAAATGTGCCCTTTGTGATTTTAAGTGCGCGCGGCCGGCATATTTGAAACGACACCTGTCGAGGCACTCCGGCGAGAAGCGCCACAAATGTCACATTTGCAATCATGAATGCAATCAGGCGTCAAATTTGAGGTTACACTTATTGACGCACACCGACGAGAGGCCGTTTAAGTGCGAACGTTGTGAATTTGCGAGCAAAACGGCAAGATATTTAAAGTTACACATGCGAGTGCATTCGGATGAAAAGCCGTACAAGTGCGACCTTTGCAAATACGCGTCTAAGTTTCAAGGTAATCTACAGAAACACCTCACGATTCACGAGAATCTGCTCAAGTGTAATATTTGTGAGTACACGTGTAAATTAGCGAGGGACTTAAAAAAGCATATGTTATCACATGCAGGTGAGATTTCTTCTTGA
Protein Sequence: MRQHMRIHSSRKPFACQICNSKFRFAGNLTRHMLVHSDKKQFVCDRCGYKCHDVGSLVQHMRIHTGERPFSCDLCPRKFQQSGNLKKHKLTHDGEKTIGCEFCDYKGRSLEDVKRHARRHSSEKPFKCALCDFKCARPAYLKRHLSRHSGEKRHKCHICNHECNQASNLRLHLLTHTDERPFKCERCEFASKTARYLKLHMRVHSDEKPYKCDLCKYASKFQGNLQKHLTIHENLLKCNICEYTCKLARDLKKHMLSHAGEISS

Sequence clustering based on sequence similarity using MMseqs2