Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.27 3.8e+02 2.8 0.0 21 44 10 33 7 38 0.89

2 11 0.0063 8.7 8.1 0.3 21 48 38 65 35 71 0.89

3 11 2.5 3.5e+03 -0.3 0.3 27 48 78 98 73 103 0.73

4 11 2.4 3.3e+03 -0.2 0.2 21 44 100 123 96 131 0.77

5 11 0.092 1.3e+02 4.3 0.0 21 49 128 156 124 159 0.85

6 11 0.0078 11 7.8 0.0 21 44 156 179 154 185 0.90

7 11 4.6 6.5e+03 -1.1 0.1 23 37 186 200 182 210 0.75

8 11 0.02 28 6.4 0.2 21 44 210 233 204 238 0.90

9 11 0.00038 0.52 12.0 0.0 21 47 238 264 235 269 0.86

10 11 0.015 20 6.9 0.0 21 52 266 296 264 298 0.92

11 11 0.23 3.2e+02 3.1 0.2 21 44 293 316 291 322 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.27	3.8e+02	2.8	0.0	21	44	10	33	7	38	0.89
2	11	0.0063	8.7	8.1	0.3	21	48	38	65	35	71	0.89
3	11	2.5	3.5e+03	-0.3	0.3	27	48	78	98	73	103	0.73
4	11	2.4	3.3e+03	-0.2	0.2	21	44	100	123	96	131	0.77
5	11	0.092	1.3e+02	4.3	0.0	21	49	128	156	124	159	0.85
6	11	0.0078	11	7.8	0.0	21	44	156	179	154	185	0.90
7	11	4.6	6.5e+03	-1.1	0.1	23	37	186	200	182	210	0.75
8	11	0.02	28	6.4	0.2	21	44	210	233	204	238	0.90
9	11	0.00038	0.52	12.0	0.0	21	47	238	264	235	269	0.86
10	11	0.015	20	6.9	0.0	21	52	266	296	264	298	0.92
11	11	0.23	3.2e+02	3.1	0.2	21	44	293	316	291	322	0.86

Coding Sequence: ATGAAACGGCATAAACtgatacacaccgacgagaaaccatTCGCTTGCAACTTTTGCGGCTATAGGTGCCGACAGAAAGGAACTTTAAAGGAGCACGTGTTaacacacaccggcgagaaaccgcacagttgtgatctttgcagtTACACTTGCCGAAGGAGTACAGCTTTGAAAGAGCACGTCATGATAGTACACGCTGGGCTAAAACCGTGCGGGCGGAAGTCATATAGTTGTGATTCGTGCGATCGAAATTGCCGATCGCGGGCAGATTTGAAGCGGCATATGTTAAAACACACCGgagagaagccgttcagttgtcaTCAGTGCGATTATAGCTGCCAAGAACGTAGACAGTTGAATGTTCACGTGCTAAAACACAGCGGggagaagccgttcagctgtgatTTTTGTGAGTCTAAATATCGAAAGCGCAACAGTTTGAAAGACCATATGCTATTGCATACCGGTGAAAAGCCCTTCAATTGTGATCTGTGCTATAAGAATTTCCGAACTCTCGCGGGGTTGAAACGACACGCGCTAATACACACTGACATAGAGCCGTTCacttgcgatctttgcgatttcaCGTGCCGAGATCCCTATGGTGTAAAAGAGCACAAGTTGACTCACGAGAAACCGGTCCGTTGTAGTGTTTGCGATTTTAAGTGCGCGAAAACAACAAATTTGAGACAGCACATGTTGACGCACTCCAAGGAAAAGCCGTTCAAGTGCAGCCTTTGCGATTCAACGTTCAGACAGAGTAGCCATTTGAAGTACCACttgttaatacacaccggcgagaagccgttcagttgtgacttTTGTGATTTCAAGTGCCGAGCTGGCGGTGATTTGAAGAGGCAcatgttaaagcacgccgacaAGCCGTTgtgttgtgatctttgcgattacagctGCCGACAAATTGATGGTTTGAAGCAGCACGTGCTTGATACGCATGTAAAAGTGGAGAACGCTTGA
Protein Sequence: MKRHKLIHTDEKPFACNFCGYRCRQKGTLKEHVLTHTGEKPHSCDLCSYTCRRSTALKEHVMIVHAGLKPCGRKSYSCDSCDRNCRSRADLKRHMLKHTGEKPFSCHQCDYSCQERRQLNVHVLKHSGEKPFSCDFCESKYRKRNSLKDHMLLHTGEKPFNCDLCYKNFRTLAGLKRHALIHTDIEPFTCDLCDFTCRDPYGVKEHKLTHEKPVRCSVCDFKCAKTTNLRQHMLTHSKEKPFKCSLCDSTFRQSSHLKYHLLIHTGEKPFSCDFCDFKCRAGGDLKRHMLKHADKPLCCDLCDYSCRQIDGLKQHVLDTHVKVENA

Sequence clustering based on sequence similarity using MMseqs2