Dhop036602.1
Basic Information
- Insect
- Dorcus hopei
- Gene Symbol
- -
- Assembly
- GCA_033060865.1
- Location
- CM065425.1:74699536-74700027[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.058 80 5.0 0.0 22 44 8 30 4 37 0.88 2 5 0.013 18 7.1 0.3 22 44 37 59 32 67 0.85 3 5 0.0046 6.4 8.5 0.1 21 49 64 91 59 93 0.90 4 5 0.0013 1.8 10.2 0.0 21 44 93 116 91 121 0.90 5 5 0.00044 0.61 11.8 0.1 21 48 121 147 118 152 0.87
Sequence Information
- Coding Sequence
- ATGTCGACGCACTTCGTCGGAGAGAAGCCCTTCCGGTGTGACATTTGCGATTACAGATCGCAACTGTTCGGTAATTTAAAACGGCACATGACCAAGCACACCGGCGGCAAGAAGCCGTTCTgctgtgacctttgcgattacaagtgccgacAACCTGGGAATTTGAGACTGCACAGGttgatacacaccggcgagaagccgttcagctgtgatctttgcgattacaggtGCCGGGAAACGGGAAAATTGAAGCGGCACATGTTGACGCACTTCGACGGggagaagccgttcagctgcgacttttgcgattacaagtgtcgaCAGTCCGGAAGCATGAAGCGGCACATGCTTAttcacaccggcgagaaaccgttcagttgcgaGTTTTGCAGTTACAAATGTCGGCAGTCCGGCAATTTAAATCAGCACATGTTGACGCATACAGGCAAGAATACTTCAAGTGCAAATATAAAGCTTGAACAGGATTTTTAA
- Protein Sequence
- MSTHFVGEKPFRCDICDYRSQLFGNLKRHMTKHTGGKKPFCCDLCDYKCRQPGNLRLHRLIHTGEKPFSCDLCDYRCRETGKLKRHMLTHFDGEKPFSCDFCDYKCRQSGSMKRHMLIHTGEKPFSCEFCSYKCRQSGNLNQHMLTHTGKNTSSANIKLEQDF
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00465609; iTF_00465457; iTF_00465463;
- 90% Identity
- iTF_00465457;
- 80% Identity
- iTF_00465457;