Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.022 31 6.3 0.0 21 44 6 29 3 33 0.89

2 5 0.00075 1 11.0 0.1 21 43 34 56 31 62 0.90

3 5 0.0006 0.83 11.3 0.0 21 46 62 86 57 90 0.86

4 5 0.035 49 5.7 0.0 21 44 90 113 86 118 0.89

5 5 0.048 67 5.2 0.0 21 43 118 140 115 145 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.022	31	6.3	0.0	21	44	6	29	3	33	0.89
2	5	0.00075	1	11.0	0.1	21	43	34	56	31	62	0.90
3	5	0.0006	0.83	11.3	0.0	21	46	62	86	57	90	0.86
4	5	0.035	49	5.7	0.0	21	44	90	113	86	118	0.89
5	5	0.048	67	5.2	0.0	21	43	118	140	115	145	0.87

Coding Sequence: atgttaaaacacaccgacgagaagccgttcagttgtgatttttgcgattataaatgccgacacgCCGGAAATCTGAAGGagcacatgttaatacacagcgacgagaagccgttcagttgcgacgtttgcgattataaatgccggctgGCCAGGAACTTGAAAAAGCATAAAGTAAAACACACCGATGATAAGCCGCTCAGTTGTGAtttctgcgattataaatgccgacaggtCGGGAACTTGAAAAggcacatgttaaaacataccggcgagaagccgttcagctgtgGTCTGTGCGGCTATCAGTGTCGACAGGTCGGAGACTTGAAAAGTCACGTGTtcatacacaccggcgagaaaccgttcagttgcgatGTCTGCGATTACAAAGCCCGATATAATCTTGCTTTGAAaaggcacaagttaaaacataaGATTTGA
Protein Sequence: MLKHTDEKPFSCDFCDYKCRHAGNLKEHMLIHSDEKPFSCDVCDYKCRLARNLKKHKVKHTDDKPLSCDFCDYKCRQVGNLKRHMLKHTGEKPFSCGLCGYQCRQVGDLKSHVFIHTGEKPFSCDVCDYKARYNLALKRHKLKHKI

Sequence clustering based on sequence similarity using MMseqs2