Dhop036633.1
Basic Information
- Insect
- Dorcus hopei
- Gene Symbol
- -
- Assembly
- GCA_033060865.1
- Location
- CM065425.1:75437704-75438144[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.022 31 6.3 0.0 21 44 6 29 3 33 0.89 2 5 0.00075 1 11.0 0.1 21 43 34 56 31 62 0.90 3 5 0.0006 0.83 11.3 0.0 21 46 62 86 57 90 0.86 4 5 0.035 49 5.7 0.0 21 44 90 113 86 118 0.89 5 5 0.048 67 5.2 0.0 21 43 118 140 115 145 0.87
Sequence Information
- Coding Sequence
- atgttaaaacacaccgacgagaagccgttcagttgtgatttttgcgattataaatgccgacacgCCGGAAATCTGAAGGagcacatgttaatacacagcgacgagaagccgttcagttgcgacgtttgcgattataaatgccggctgGCCAGGAACTTGAAAAAGCATAAAGTAAAACACACCGATGATAAGCCGCTCAGTTGTGAtttctgcgattataaatgccgacaggtCGGGAACTTGAAAAggcacatgttaaaacataccggcgagaagccgttcagctgtgGTCTGTGCGGCTATCAGTGTCGACAGGTCGGAGACTTGAAAAGTCACGTGTtcatacacaccggcgagaaaccgttcagttgcgatGTCTGCGATTACAAAGCCCGATATAATCTTGCTTTGAAaaggcacaagttaaaacataaGATTTGA
- Protein Sequence
- MLKHTDEKPFSCDFCDYKCRHAGNLKEHMLIHSDEKPFSCDVCDYKCRLARNLKKHKVKHTDDKPLSCDFCDYKCRQVGNLKRHMLKHTGEKPFSCGLCGYQCRQVGDLKSHVFIHTGEKPFSCDVCDYKARYNLALKRHKLKHKI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00465487;
- 90% Identity
- iTF_00465487;
- 80% Identity
- iTF_00465487;