Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.038 53 5.5 0.1 21 43 6 28 3 33 0.90

2 10 0.0087 12 7.6 0.0 21 48 34 60 29 65 0.89

3 10 0.012 16 7.2 1.0 21 43 62 84 60 90 0.90

4 10 0.11 1.6e+02 4.0 0.0 21 44 90 113 85 118 0.79

5 10 0.016 23 6.7 0.1 21 48 118 144 115 146 0.90

6 10 0.0098 14 7.4 0.1 16 43 141 168 139 174 0.88

7 10 0.069 95 4.7 0.2 21 48 174 200 170 206 0.84

8 10 0.01 14 7.4 0.1 19 43 228 252 216 257 0.80

9 10 0.0089 12 7.6 0.1 21 43 258 280 253 286 0.87

10 10 0.078 1.1e+02 4.6 0.4 19 43 284 308 280 317 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.038	53	5.5	0.1	21	43	6	28	3	33	0.90
2	10	0.0087	12	7.6	0.0	21	48	34	60	29	65	0.89
3	10	0.012	16	7.2	1.0	21	43	62	84	60	90	0.90
4	10	0.11	1.6e+02	4.0	0.0	21	44	90	113	85	118	0.79
5	10	0.016	23	6.7	0.1	21	48	118	144	115	146	0.90
6	10	0.0098	14	7.4	0.1	16	43	141	168	139	174	0.88
7	10	0.069	95	4.7	0.2	21	48	174	200	170	206	0.84
8	10	0.01	14	7.4	0.1	19	43	228	252	216	257	0.80
9	10	0.0089	12	7.6	0.1	21	43	258	280	253	286	0.87
10	10	0.078	1.1e+02	4.6	0.4	19	43	284	308	280	317	0.82

Coding Sequence: atgttaacgcacacgGGAGAGAAACcgctcagttgtgatctttgcgattacaaatgctcCCAGGCCGGAAACTTGGCGAGACATAGGTTAACACACACCGGGGAGAAGCCTTTTGCTTGCGACCTTTGCAGTTACAAATGCCGAGACTCAGGTTCTTTGAAAAAGCACgaattaaagcacaccgacgagaagcctttCGCCTGCGACCTTTGCAGTTACAAGTGTCGAGAATCCAGAAGATTTAGACAACACAGGTTGACAcataccggtgagaagccgttcagttgtgacctttgcgattacaaaagcATAGAGAATGAAAAGTTGCGACGTCACATGTTAACCCACACGGGAGAGAAACCGCTCAGCTGCGacttttgcgattacaaatgtagCCAAGCCGGAAACTTGGCGAGACACAGGTTAagacacaccggcgagaagcctttCGCTTGCGACCTTTGCAGTTACAAATGCCGAGACTCCGGATCTTTGAAAAAGCACgggttaaagcacaccgacgagaagcctttCGCCTGCGACCTTTGCAGTTACAAGTGTCGAGAATCCGGAAGGTTGAAACAACACAGGTTGACACATACCGGTAAGAAGCCGctcagttgtaatctttgcgattacaaaagcATGAAGAAGGAAAAGTTGCGAAGTCACATGTTAACGCACAAGGGAGAGAAACcgctcagttgtgatctttgcgattacaagtgtaGCCAGGCCGGAAACTTGACGAGACACAGATtaacgcacaccggcgagaagcctttCGCGTGCGACCTTTGCAGTTACAAATGTCGGGACTCCGGATCTTTGAAAAGGCACaggttaaagcacaccgacgagaagcctttCGCCTGCGACCTTTGCAGTTACAAGTGTCGAGAATCCGGAAGGTTGAAACATCACAGGTTGACGCATACCGGtgaaaagccgttcagttgtgatttttgcgattacaaatgctgGAGGCGCGAGTACTTCATGAAACATAGGTTAACGCACAGTCAGTCGTGTGAATCGAAAACGGATtaa
Protein Sequence: MLTHTGEKPLSCDLCDYKCSQAGNLARHRLTHTGEKPFACDLCSYKCRDSGSLKKHELKHTDEKPFACDLCSYKCRESRRFRQHRLTHTGEKPFSCDLCDYKSIENEKLRRHMLTHTGEKPLSCDFCDYKCSQAGNLARHRLRHTGEKPFACDLCSYKCRDSGSLKKHGLKHTDEKPFACDLCSYKCRESGRLKQHRLTHTGKKPLSCNLCDYKSMKKEKLRSHMLTHKGEKPLSCDLCDYKCSQAGNLTRHRLTHTGEKPFACDLCSYKCRDSGSLKRHRLKHTDEKPFACDLCSYKCRESGRLKHHRLTHTGEKPFSCDFCDYKCWRREYFMKHRLTHSQSCESKTD

Sequence clustering based on sequence similarity using MMseqs2