Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 1.3e-05 0.018 16.6 0.2 18 44 7 33 2 38 0.89

2 5 9.7e-07 0.0014 20.3 0.2 21 44 38 61 35 71 0.86

3 5 1.7e-06 0.0023 19.5 0.1 22 44 95 117 90 121 0.91

4 5 0.068 95 4.7 0.2 21 43 122 144 119 154 0.84

5 5 0.0026 3.6 9.3 0.0 23 45 152 174 142 178 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	1.3e-05	0.018	16.6	0.2	18	44	7	33	2	38	0.89
2	5	9.7e-07	0.0014	20.3	0.2	21	44	38	61	35	71	0.86
3	5	1.7e-06	0.0023	19.5	0.1	22	44	95	117	90	121	0.91
4	5	0.068	95	4.7	0.2	21	43	122	144	119	154	0.84
5	5	0.0026	3.6	9.3	0.0	23	45	152	174	142	178	0.87

Coding Sequence: ATGAAGGAACACAAATTCAGACATACCAACGAGAGGCCCTTCACTTGTGAAATTTGCGATTGTAATTTCAGAGAACTTAGAACCTTGAAGCGGCACGTGTTAACGCACAACAAAGAGGAGCCCTTCACTTGTGGAATTTGCGATCGTAGTTACAGACAACTTAGAAACTTGAAACGGCACGCGTTAACGCACAACAAAGAGAAGCCCTTCGCTTGTAAAACTTGCGATCTTCAATTTAAGCGACTCGCAATCTTGGAAGagcacatgttaacgcacaACATAGAGAAGCCCTTCACTTGTAAAATTTGCAATCGTGGATTCACACAAATGAGAAATTTAAAACGCCATTTATtaacacacaccgacgagaagcctttcagttgcgatctttgcgattacaagtgtcgaCGATCCCAACGTATGAAGGAACACAAATTAAGTCATGCCAACGTGAAGCCCTTCACTTGTAAAATTTGCGATCGTGGATTCACACAAATGGGAGCATTGAAGCGCCACTTGTTAAACACACACAAGTGA
Protein Sequence: MKEHKFRHTNERPFTCEICDCNFRELRTLKRHVLTHNKEEPFTCGICDRSYRQLRNLKRHALTHNKEKPFACKTCDLQFKRLAILEEHMLTHNIEKPFTCKICNRGFTQMRNLKRHLLTHTDEKPFSCDLCDYKCRRSQRMKEHKLSHANVKPFTCKICDRGFTQMGALKRHLLNTHK

Sequence clustering based on sequence similarity using MMseqs2