Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 7.6e-05 0.11 14.2 0.1 18 44 7 33 2 38 0.89

2 7 1.2e-05 0.017 16.7 0.2 19 47 41 69 35 76 0.86

3 7 0.62 8.7e+02 1.7 0.4 21 48 71 97 68 99 0.81

4 7 2.6e-05 0.036 15.7 0.8 16 44 94 122 83 128 0.85

5 7 1.4e-06 0.002 19.7 0.1 20 44 134 158 126 163 0.89

6 7 0.1 1.4e+02 4.2 0.2 21 43 163 185 160 194 0.84

7 7 0.0042 5.9 8.6 0.0 23 45 193 215 188 219 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	7.6e-05	0.11	14.2	0.1	18	44	7	33	2	38	0.89
2	7	1.2e-05	0.017	16.7	0.2	19	47	41	69	35	76	0.86
3	7	0.62	8.7e+02	1.7	0.4	21	48	71	97	68	99	0.81
4	7	2.6e-05	0.036	15.7	0.8	16	44	94	122	83	128	0.85
5	7	1.4e-06	0.002	19.7	0.1	20	44	134	158	126	163	0.89
6	7	0.1	1.4e+02	4.2	0.2	21	43	163	185	160	194	0.84
7	7	0.0042	5.9	8.6	0.0	23	45	193	215	188	219	0.88

Coding Sequence: ATGAAGGAACACAAATTAAGACATACCAACGAGAAGCCTTTCACTTGCGAAATTTGCGATCGTAACTTCAGACAACTTAGTGTCTTGAAACGCCACGTGTTAACGCACAACACAACAACACAACAACAAGAGAAGCCCTTCACTTGTAAAATTTGCGATCGTAGGTTCACACAGGCCGGACATTTGAGACGCCACgtgttaatacacaccggcgagaagcctttcagttgcgatctttgcgattacaagtgtcgaCGACCCGAAAGAATGAAGGAACACAAATTAAGACATACCAACGAGAAGCCCTTCACTTGTGAAATTTGCGATCGTAATTTCAGAGAACTTAGAACCTTGAAACGCCACGTGTTAACGCACAACACAACAACACAACAACACAACAACATAGAGAAGCCCTTCACTTGTAAAATTTGCAATCGTGGATTCACACAAATGAGAAATTTAAAACGCCATTTATtaacacacaccgacgagaagcctttcagttgcgatctttgcgattacaagtgtcgaCGATCCCAACGTATGAAGGAACACAAATTAAGCCATGCCAACGTGAAGCCCTTCACTTGTAAAATTTGCGATCGTGGATTCACACAAATGGGAACATTGAAACGCCACTTGTTAAACACACACAAGTGA
Protein Sequence: MKEHKLRHTNEKPFTCEICDRNFRQLSVLKRHVLTHNTTTQQQEKPFTCKICDRRFTQAGHLRRHVLIHTGEKPFSCDLCDYKCRRPERMKEHKLRHTNEKPFTCEICDRNFRELRTLKRHVLTHNTTTQQHNNIEKPFTCKICNRGFTQMRNLKRHLLTHTDEKPFSCDLCDYKCRRSQRMKEHKLSHANVKPFTCKICDRGFTQMGTLKRHLLNTHK

Sequence clustering based on sequence similarity using MMseqs2