Basic Information

Insect: Dorcus hopei
Gene Symbol: -
Assembly: GCA_033060865.1
Location: CM065425.1:72244304-72250441[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 14 0.0021 0.23 13.5 5.1 1 23 14 36 14 36 0.98

2 14 0.0003 0.033 16.1 3.1 1 20 42 61 42 63 0.95

3 14 0.00012 0.014 17.3 2.8 2 23 100 121 99 121 0.96

4 14 0.00053 0.059 15.3 0.4 1 23 127 149 127 149 0.98

5 14 0.016 1.8 10.7 1.6 1 23 155 177 155 177 0.97

6 14 7.2e-06 0.0008 21.2 3.0 1 23 183 205 183 205 0.98

7 14 0.014 1.6 10.8 5.4 1 23 211 233 211 233 0.98

8 14 2.5e-05 0.0028 19.5 2.1 1 23 239 261 239 261 0.98

9 14 0.0014 0.15 14.0 2.2 1 23 267 289 267 289 0.97

10 14 0.0068 0.75 11.9 2.6 3 23 297 317 297 317 0.99

11 14 0.00062 0.069 15.1 4.0 2 23 324 345 323 345 0.96

12 14 0.0046 0.5 12.4 3.2 1 23 352 374 352 374 0.98

13 14 0.0011 0.12 14.3 4.0 3 23 382 402 380 402 0.97

14 14 0.47 52 6.1 1.1 3 23 410 430 408 430 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	14	0.0021	0.23	13.5	5.1	1	23	14	36	14	36	0.98
2	14	0.0003	0.033	16.1	3.1	1	20	42	61	42	63	0.95
3	14	0.00012	0.014	17.3	2.8	2	23	100	121	99	121	0.96
4	14	0.00053	0.059	15.3	0.4	1	23	127	149	127	149	0.98
5	14	0.016	1.8	10.7	1.6	1	23	155	177	155	177	0.97
6	14	7.2e-06	0.0008	21.2	3.0	1	23	183	205	183	205	0.98
7	14	0.014	1.6	10.8	5.4	1	23	211	233	211	233	0.98
8	14	2.5e-05	0.0028	19.5	2.1	1	23	239	261	239	261	0.98
9	14	0.0014	0.15	14.0	2.2	1	23	267	289	267	289	0.97
10	14	0.0068	0.75	11.9	2.6	3	23	297	317	297	317	0.99
11	14	0.00062	0.069	15.1	4.0	2	23	324	345	323	345	0.96
12	14	0.0046	0.5	12.4	3.2	1	23	352	374	352	374	0.98
13	14	0.0011	0.12	14.3	4.0	3	23	382	402	380	402	0.97
14	14	0.47	52	6.1	1.1	3	23	410	430	408	430	0.95

Sequence Information

Coding Sequence: ATGACGCTGCACAAATTGAACCATACCGACGAGAAGCGGTTCAGTTGCGGCCTTTGCGAATACAAGTGCCAGCGAGCGGCACATTTGAAGCGGCACATGTTCACACACAACGACGAAAAACCGTTCACCTGTGAGGTTTGCGATCACAAATTCAATCGTCTCGAACACTTGAAGAGCCACCAATACCGGCGGATTAAGGACGAAATAACAGAAGAATGTGGTCCATGTGGTTCCAAACTTGAATCGCACAGAAGTTTGCGCGAGCACACACCGAAACGCACAGACGAGAAGCCGCTTACATGTGACGCATGCGACTGCAAATTTCGAGACGCTCGGAAATTGAAGCGGCACATGTTAACACATACTGgggagaaaccgttcagttgcgacCTTTGCACCTACGAAGGCGATCAACTGCAACAACTGAAAGCGCACATGCGAACACACACCGGCGCGAAACTATTTAAGTGCGACTTCTGTGACTACGAGTCCCGACTGTCCTCACGTTTGAAACGTCACTCATTAATACACACCGGTGAAAAGCCGTTCAGCTGCGAGCTTTGCGATTGCAGATTCCGCTTTTCGTCTAACTTGGCGCAGCACATGTTAACGCACTcaggcgagaagccgttcagttgcgatcaCTGCGCTTATAAATGCGGACAAATCACAAATTTCAGGAGGCACATGCTAACGCATACGGAAACCAAACCGTACAGTTGCGATTCTTGCAGTTACAAATCTCGACAAtcctcaaatttaaaaaagcacatGATGATACACACTGGGGAAAAACCGTTTGCTTGTAGCGTTTGCGATTTCAAGTGCCGACAATCCGGAGATATGAAGCGCCACGAATTgacgcacaccgacgagaagccgttgggttgtaatttttgcgattacaagtgccgaGGGGCCCGAAGTTTAAGGCagcacatgttaatacacaccggcgagaagccgctGAGTTGCGgcgtttgcgattataaatgtcgccATCTTGGAACCTTGAGGCGGCACATGTTAAAGCACACGGTCGACGTGAAACCGTACAGCTGTAATGTTTGCGAGTACAAGTGCCAAAAGTCCGAGGACATGAGGCGTCACTTGTTGACGCACACGGGCGGAAAGCGGTTCGGTTGTGACCTGTGCGGTTACAGATGCCGACGGCTCGCGCATTTGAAACAGCACCTGCTGAGACATTcgggcgagaaaccgttcggttgtgacctttgcgattataaatgcctaGTTAAGGCAAGTTTGAAGAAGCACTTGTTGGCACATACACTTGATAAGAAACAATAA
Protein Sequence: MTLHKLNHTDEKRFSCGLCEYKCQRAAHLKRHMFTHNDEKPFTCEVCDHKFNRLEHLKSHQYRRIKDEITEECGPCGSKLESHRSLREHTPKRTDEKPLTCDACDCKFRDARKLKRHMLTHTGEKPFSCDLCTYEGDQLQQLKAHMRTHTGAKLFKCDFCDYESRLSSRLKRHSLIHTGEKPFSCELCDCRFRFSSNLAQHMLTHSGEKPFSCDHCAYKCGQITNFRRHMLTHTETKPYSCDSCSYKSRQSSNLKKHMMIHTGEKPFACSVCDFKCRQSGDMKRHELTHTDEKPLGCNFCDYKCRGARSLRQHMLIHTGEKPLSCGVCDYKCRHLGTLRRHMLKHTVDVKPYSCNVCEYKCQKSEDMRRHLLTHTGGKRFGCDLCGYRCRRLAHLKQHLLRHSGEKPFGCDLCDYKCLVKASLKKHLLAHTLDKKQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00465617; iTF_00466777;
90% Identity: iTF_00465617; iTF_00466777;
80% Identity: iTF_00465617;