Basic Information

Insect: Dorcus hopei
Gene Symbol: -
Assembly: GCA_033060865.1
Location: CM065425.1:72096552-72097934[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 16 0.00042 0.046 15.7 4.6 1 23 10 32 10 32 0.98

2 16 0.0027 0.3 13.1 2.0 3 23 40 60 39 60 0.97

3 16 0.00042 0.047 15.7 4.0 2 23 67 88 66 88 0.96

4 16 0.02 2.2 10.4 6.5 2 23 96 117 95 117 0.96

5 16 0.12 14 7.9 7.7 1 23 123 145 123 145 0.98

6 16 0.0074 0.82 11.7 2.1 3 23 153 173 151 173 0.98

7 16 0.23 26 7.0 4.4 2 23 180 201 179 201 0.96

8 16 0.082 9 8.5 3.2 2 23 209 230 208 230 0.96

9 16 0.00027 0.03 16.3 0.3 1 23 237 259 237 259 0.98

10 16 6.9e-05 0.0076 18.1 0.9 1 23 265 287 265 287 0.97

11 16 0.0011 0.12 14.4 3.6 1 23 293 315 293 315 0.97

12 16 0.0022 0.24 13.4 0.5 1 23 323 345 323 345 0.98

13 16 0.00014 0.015 17.2 1.4 1 23 351 373 351 373 0.98

14 16 0.00015 0.016 17.1 1.4 1 23 379 401 379 401 0.98

15 16 2.6e-05 0.0029 19.4 4.1 1 23 407 429 407 429 0.98

16 16 0.0026 0.29 13.2 3.5 1 23 434 456 434 456 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	16	0.00042	0.046	15.7	4.6	1	23	10	32	10	32	0.98
2	16	0.0027	0.3	13.1	2.0	3	23	40	60	39	60	0.97
3	16	0.00042	0.047	15.7	4.0	2	23	67	88	66	88	0.96
4	16	0.02	2.2	10.4	6.5	2	23	96	117	95	117	0.96
5	16	0.12	14	7.9	7.7	1	23	123	145	123	145	0.98
6	16	0.0074	0.82	11.7	2.1	3	23	153	173	151	173	0.98
7	16	0.23	26	7.0	4.4	2	23	180	201	179	201	0.96
8	16	0.082	9	8.5	3.2	2	23	209	230	208	230	0.96
9	16	0.00027	0.03	16.3	0.3	1	23	237	259	237	259	0.98
10	16	6.9e-05	0.0076	18.1	0.9	1	23	265	287	265	287	0.97
11	16	0.0011	0.12	14.4	3.6	1	23	293	315	293	315	0.97
12	16	0.0022	0.24	13.4	0.5	1	23	323	345	323	345	0.98
13	16	0.00014	0.015	17.2	1.4	1	23	351	373	351	373	0.98
14	16	0.00015	0.016	17.1	1.4	1	23	379	401	379	401	0.98
15	16	2.6e-05	0.0029	19.4	4.1	1	23	407	429	407	429	0.98
16	16	0.0026	0.29	13.2	3.5	1	23	434	456	434	456	0.99

Sequence Information

Coding Sequence: ATGCTgacgcacaccgacgagaaaccgttcaagTGCGCCATCTGCGGTTACGAATGCAAAACGTCCACTCGTTTGAAACATCACATGTCAATACACGACGACGAGAAGCCGGTCGCCTGCGACCGTTGCGATTTCAAATGCAAAACGGCGGGAAAACTGAAGTCGCACATGTTAATACACGCCGACGAGAAACCGATCAGTTGTGACCtatgcgattacaaatgccgacggTCTTCGCTgttgaagcggcacaagttgAAACACACCGATGCCGAAAAGTCGTTGAGCTGTGACGtctgcgattacaagtgccgacATCACGTAGACCTGAAAAACCACAAGCTAACACATACCGACGAGAAGCGGTTCAGTTGTACCCTCTGCGCATTTAAATGCCGACACGCCAGTACTTTAAAACACCACGTGTCGACACACagcgacgagaagccgttcggttgtaatctctgcgattacaaatgtaaAGTGGAACGAACGTTGAAGTCGCACATGttgatacacaccggcgagaagccgctcagttgtgatctttgcgattacaagtgtcgaCAGTTCATAACGATGAAGCGCCACAAGTTGAAGCACACGGACCCCGAAAAGTCGTTGAGTTGCGAcgtttgcgattacaagtgccgtTATTACATAGACATGAGGAAGCACAAGTTGAAGCACACCGACAGCGAGAAACGCTTCAGTTGTACcatttgcgattataaaggcCGACTGGCCGGAAACTTGAAACAGCACATGTCGGTACACTCTGAAGAGAGGCCTTTCGCATGTGCAGTTTGCGATTCCAAATTCCGACAATTGTACAAGCTAAAGAGACACATGTCtatacataccggcgagaagccgtacagttgcgacctttgcgattataagtgtcgAGATGCCTCGTTTTTGAAGCGGCACAGTTTAAGACATAACAGCGGCGGCGAGAAGCGCTTCAGTTGCGAGCTCTGCGATTACAAAACTCAGGTGGCCGCACGTTTGCGACGGCATATGTTAACGCACACCGACAAGAAACCCTTCACTTGCGGTGTTTGCGACCATAAGTCTCGAACGCGCGACGATTTGAAACGTCACGTGTTGGTGCACACCGACAagaagccgttcagctgtgacctttgcgattacaagggCCGAACGAACTCAAGTTTGATCAAGCACAAGCAgacgcacaccgacgagaaaccgttcgttTGTAGCGTTTGCGATCACCGATTTCGACACCTCGCAAAGTTGAAACGGCACATGTCGGTACACAATCGGGAGAAGTTTAAATGCGATCGCTGCTTTTACGAGAGCAGAACTTTAGGACATTTGAAAATGCATATGAAAGTACATAACGCTAAAACTTGA
Protein Sequence: MLTHTDEKPFKCAICGYECKTSTRLKHHMSIHDDEKPVACDRCDFKCKTAGKLKSHMLIHADEKPISCDLCDYKCRRSSLLKRHKLKHTDAEKSLSCDVCDYKCRHHVDLKNHKLTHTDEKRFSCTLCAFKCRHASTLKHHVSTHSDEKPFGCNLCDYKCKVERTLKSHMLIHTGEKPLSCDLCDYKCRQFITMKRHKLKHTDPEKSLSCDVCDYKCRYYIDMRKHKLKHTDSEKRFSCTICDYKGRLAGNLKQHMSVHSEERPFACAVCDSKFRQLYKLKRHMSIHTGEKPYSCDLCDYKCRDASFLKRHSLRHNSGGEKRFSCELCDYKTQVAARLRRHMLTHTDKKPFTCGVCDHKSRTRDDLKRHVLVHTDKKPFSCDLCDYKGRTNSSLIKHKQTHTDEKPFVCSVCDHRFRHLAKLKRHMSVHNREKFKCDRCFYESRTLGHLKMHMKVHNAKT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00465638;
90% Identity: iTF_00465638;
80% Identity: iTF_00465638;