Dnox002009.1
Basic Information
- Insect
- Diuraphis noxia
- Gene Symbol
- -
- Assembly
- GCA_001186385.1
- Location
- NW:140379-140846[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.00015 1.8 8.2 0.2 27 44 6 23 2 31 0.87 2 5 0.0065 80 2.9 0.2 21 43 28 50 23 54 0.81 3 5 9.9e-05 1.2 8.8 0.1 15 43 50 78 46 82 0.85 4 5 2.7e-05 0.33 10.6 0.1 17 43 80 106 77 110 0.85 5 5 0.013 1.6e+02 2.0 0.1 20 47 111 138 106 142 0.73
Sequence Information
- Coding Sequence
- atgaagaattaTCCATGTCATATCTGTGAAAAATCGTTCAACCAAAGTAGCAATTTGACGAGACATCGACGCACACACTCTGGCGAAAAACCATACGGGTGCGACGTGTGCGACAAATCGTTCAGCCAGAGAAGCCATTTGACAAAACATCGACGCACACACTCTGGTGAAAAACCATACGGGTGCGACGCGTGCGGCAAATCGTTCAGCCAGAGTAGCAATTTGACAAAACATCGACGCACACACTCTGGCGAAAGACCATACGTGTGCGACGTGTGCGACAAATCGTTCAGCCAGAGTAGCAATTTGACAAAACATCGACGCACACACTCTGGCGAAAGACCATACGTGTGCGACGTGTGTGACAAGTCGTTCTTTACAAGCTCCAGTTTAACGAAACCTATAAATGTACGTACATGGCAATCTGATCAATATGATCAAATATCCGAGATCCAAGGATTGTATTGA
- Protein Sequence
- MKNYPCHICEKSFNQSSNLTRHRRTHSGEKPYGCDVCDKSFSQRSHLTKHRRTHSGEKPYGCDACGKSFSQSSNLTKHRRTHSGERPYVCDVCDKSFSQSSNLTKHRRTHSGERPYVCDVCDKSFFTSSSLTKPINVRTWQSDQYDQISEIQGLY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00463538;
- 90% Identity
- iTF_00463538;
- 80% Identity
- iTF_00463538;