Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00015 1.8 8.2 0.2 27 44 6 23 2 31 0.87

2 5 0.0065 80 2.9 0.2 21 43 28 50 23 54 0.81

3 5 9.9e-05 1.2 8.8 0.1 15 43 50 78 46 82 0.85

4 5 2.7e-05 0.33 10.6 0.1 17 43 80 106 77 110 0.85

5 5 0.013 1.6e+02 2.0 0.1 20 47 111 138 106 142 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00015	1.8	8.2	0.2	27	44	6	23	2	31	0.87
2	5	0.0065	80	2.9	0.2	21	43	28	50	23	54	0.81
3	5	9.9e-05	1.2	8.8	0.1	15	43	50	78	46	82	0.85
4	5	2.7e-05	0.33	10.6	0.1	17	43	80	106	77	110	0.85
5	5	0.013	1.6e+02	2.0	0.1	20	47	111	138	106	142	0.73

Coding Sequence: atgaagaattaTCCATGTCATATCTGTGAAAAATCGTTCAACCAAAGTAGCAATTTGACGAGACATCGACGCACACACTCTGGCGAAAAACCATACGGGTGCGACGTGTGCGACAAATCGTTCAGCCAGAGAAGCCATTTGACAAAACATCGACGCACACACTCTGGTGAAAAACCATACGGGTGCGACGCGTGCGGCAAATCGTTCAGCCAGAGTAGCAATTTGACAAAACATCGACGCACACACTCTGGCGAAAGACCATACGTGTGCGACGTGTGCGACAAATCGTTCAGCCAGAGTAGCAATTTGACAAAACATCGACGCACACACTCTGGCGAAAGACCATACGTGTGCGACGTGTGTGACAAGTCGTTCTTTACAAGCTCCAGTTTAACGAAACCTATAAATGTACGTACATGGCAATCTGATCAATATGATCAAATATCCGAGATCCAAGGATTGTATTGA
Protein Sequence: MKNYPCHICEKSFNQSSNLTRHRRTHSGEKPYGCDVCDKSFSQRSHLTKHRRTHSGEKPYGCDACGKSFSQSSNLTKHRRTHSGERPYVCDVCDKSFSQSSNLTKHRRTHSGERPYVCDVCDKSFFTSSSLTKPINVRTWQSDQYDQISEIQGLY

Sequence clustering based on sequence similarity using MMseqs2