Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 4.1 1.2e+04 -2.8 0.0 12 23 45 56 43 64 0.78

2 2 7.7e-27 2.2e-23 82.8 11.6 1 69 72 140 72 141 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	4.1	1.2e+04	-2.8	0.0	12	23	45	56	43	64	0.78
2	2	7.7e-27	2.2e-23	82.8	11.6	1	69	72	140	72	141	0.97

Coding Sequence: ATGGAAGCGGACTTAAATCACAGCTACCCAACCACGGCGCCACCACCATACTCTGGTCCACTTGAGACCACCACTCGCCAACCATTTGTGTCTGGTAACAATGGTCAACATTCCACGTATACCGCATACCCCAATCAAGCCACGGTCACTGTTGTTCGTAGCCAACCCGTGGTTTCAGGGGTTCAGCATATTGTTATTGCAAATAGTATGAGTCCCCATCCTTCTCCATATACCTGCCCGTCGTGTAACCTGCAAATAATAACCAGGACTGAACGGAAAACCACTCTTAGGACTCACCTCTGTGCTGCATTACTCTGCGTATTAGCGTTATGGCCCTGCGCCATTATTCCATACTGCATGGACAGTTGTAACAACATTGACCATTACTGCCCCAACTGCTCTGCGTATCTTGGGACGTAcatggtataa
Protein Sequence: MEADLNHSYPTTAPPPYSGPLETTTRQPFVSGNNGQHSTYTAYPNQATVTVVRSQPVVSGVQHIVIANSMSPHPSPYTCPSCNLQIITRTERKTTLRTHLCAALLCVLALWPCAIIPYCMDSCNNIDHYCPNCSAYLGTYMV

Sequence clustering based on sequence similarity using MMseqs2