Druf079660.1
Basic Information
- Insect
- Dioctria rufipes
- Gene Symbol
- ftz-f1
- Assembly
- GCA_963924295.1
- Location
- OZ002743.1:39841800-39842489[+]
Transcription Factor Domain
- TF Family
- SF-like
- Domain
- zf-C4|SF-like
- PFAM
- AnimalTFDB
- TF Group
- Zinc-Coordinating Group
- Description
- The ligand binding domain of nuclear receptor steroidogenic factor 1 (SF-1): SF-1, a member of the nuclear hormone receptor superfamily, is an essential regulator of endocrine development and function and is considered a master regulator of reproduction. Most nuclear receptors function as homodimer or heterodimers, however SF-1 binds to its target genes as a monomer, recognizing the variations of the DNA sequence motif, T/CCA AGGTCA. SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been determined as potential ligands of SF-1. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, SF-1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). [1, 8, 3, 11, 6, 5, 12, 10, 9, 2, 4, 7]
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.6e-51 1.4e-46 162.4 0.3 243 409 1 164 1 165 0.98
Sequence Information
- Coding Sequence
- ATGAAACTACTTCAGCACTCATGGTCAGATATGCTTGTACTTGATCATCTGCATCAAAGGATACACAATGGCTTGCCAGATGAGACTCCACTACATAACGGGCAACAATTTAATTTGCTTTTCCTAGGCCTTCTGGGTGTACCACAGTTGGCCGATTACTTCAATGAACTCCAAAATAAACTGCAGGAATTGAAGTTTGACATGGGAGACTACGTCTGTATGAAATTCCTAATCCTACTTAATCCAAaTGTTCGAGGAATAATTAACAAGAAAACAGTCCTAGAGGGACATGAAAATGTTCAAGCAGCCCTCCTAGATTACACCTTGACATGTTATCCTTCAGTGACGGATAAATTTAGTCGACTGTTAAGTATACTGCCGGAAATCCATGCTATGGCAGCTCGAGGAGAAGAACACTTATATCTCAAACATTGTGCTGGTAGTGCCCCAACACAAACACTTCTCATGGAAATGTTACATGCAAAGCGGAAagtgtaa
- Protein Sequence
- MKLLQHSWSDMLVLDHLHQRIHNGLPDETPLHNGQQFNLLFLGLLGVPQLADYFNELQNKLQELKFDMGDYVCMKFLILLNPNVRGIINKKTVLEGHENVQAALLDYTLTCYPSVTDKFSRLLSILPEIHAMAARGEEHLYLKHCAGSAPTQTLLMEMLHAKRKV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00453529; iTF_01183878; iTF_01297428; iTF_01297584; iTF_00628406; iTF_01540374; iTF_01540428; iTF_00424695; iTF_01519410; iTF_01519026; iTF_00324502; iTF_01160504; iTF_01136833; iTF_00103042; iTF_00345122; iTF_01288260; iTF_00948870; iTF_01471471; iTF_01524944; iTF_00753841; iTF_00097843; iTF_01136979; iTF_00106455; iTF_01461943; iTF_00097816; iTF_01524856; iTF_01288185; iTF_00103068; iTF_00753788; iTF_00948796; iTF_00104446; iTF_00104416; iTF_00106432; iTF_01399546; iTF_00688705; iTF_01326465; iTF_01375010; iTF_00456227; iTF_01321956; iTF_00556581; iTF_01201704; iTF_01486280; iTF_01313065; iTF_01374985; iTF_00688746; iTF_01486218; iTF_00556555; iTF_01201644; iTF_00894029; iTF_00577838; iTF_01196046; iTF_01398574; iTF_00427186; iTF_01168466; iTF_01313043; iTF_01174294; iTF_00427319; iTF_00577816; iTF_00456058; iTF_01196026; iTF_00456059; iTF_01168507; iTF_01398523; iTF_01174332; iTF_00893917; iTF_01326429; iTF_01397470; iTF_01399487; iTF_01321984; iTF_01397536; iTF_00936576; iTF_01461211;
- 90% Identity
- iTF_01399546;
- 80% Identity
- iTF_00453529;