Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 4.2e-05 0.25 11.9 0.2 17 44 16 43 11 48 0.90

2 5 0.0021 13 6.4 0.1 21 45 48 72 44 79 0.86

3 5 0.0053 32 5.2 0.1 21 43 76 98 68 104 0.87

4 5 0.00066 3.9 8.1 0.1 21 46 104 129 99 135 0.86

5 5 0.0062 37 4.9 0.0 21 43 132 154 128 160 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	4.2e-05	0.25	11.9	0.2	17	44	16	43	11	48	0.90
2	5	0.0021	13	6.4	0.1	21	45	48	72	44	79	0.86
3	5	0.0053	32	5.2	0.1	21	43	76	98	68	104	0.87
4	5	0.00066	3.9	8.1	0.1	21	46	104	129	99	135	0.86
5	5	0.0062	37	4.9	0.0	21	43	132	154	128	160	0.89

Coding Sequence: atgaatatgaataataaagataatgataaatattccCAATTTCATGCACAATCAAGAGCTGAGAAACCATTTTCATGTAGTTATTGTTCGAAAACATTTACTCAAATAACAAATTTGAAACGTCATGAACGTATTCATACTGGTGAGAAACCATCTTCATGTAGTTATTGTTCGAAAACATTTACTCAAATAACAAATTTGAAAAGTCATGAACGTGTTCATACTGGTGAAAAACCATTTACATGCAGTTATTGTCCGAAAACATTTAATCGATCACAACATTTGAAAAGTCATGAACGTATTCATACTGGTGAAAAACCATTTACATGCAGTTATTGTCCGAAAACATTTActcaaatacaaaatttgaaaaCTCATGAACGTATTCATACTGGTGAAAAACCATTTTCATGCAGTGATTGTCCGAAAATCTTTAATCATTCGTCAAATCTAAAAAATCATGAACGTATCCACACAGGTGATGAACCATTACCTAATCCTTGTTATGGCAAcgaatttaataaatctatCGATTTAAAAGATGATAAACCTAACAATACTAATGATATAAATCcatttgtttgtaaatattgtccattaccatttaataaaaaaaatcattag
Protein Sequence: MNMNNKDNDKYSQFHAQSRAEKPFSCSYCSKTFTQITNLKRHERIHTGEKPSSCSYCSKTFTQITNLKSHERVHTGEKPFTCSYCPKTFNRSQHLKSHERIHTGEKPFTCSYCPKTFTQIQNLKTHERIHTGEKPFSCSDCPKIFNHSSNLKNHERIHTGDEPLPNPCYGNEFNKSIDLKDDKPNNTNDINPFVCKYCPLPFNKKNH

Sequence clustering based on sequence similarity using MMseqs2