Doo031292.1
Basic Information
- Insect
- Dicycla oo
- Gene Symbol
- -
- Assembly
- GCA_948252095.1
- Location
- OX411713.1:7844618-7845334[-]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 0.039 48 5.5 0.0 21 45 10 34 6 35 0.88 2 9 0.08 1e+02 4.5 0.0 21 44 32 55 30 56 0.92 3 9 0.063 79 4.9 0.0 21 44 54 77 51 79 0.88 4 9 0.52 6.6e+02 1.9 0.0 22 45 77 100 75 101 0.86 5 9 0.1 1.3e+02 4.2 0.0 21 44 98 121 94 123 0.90 6 9 1.5 1.9e+03 0.4 0.0 21 44 120 143 118 145 0.86 7 9 0.72 9e+02 1.5 0.0 21 44 142 165 139 167 0.87 8 9 0.38 4.8e+02 2.4 0.0 21 44 164 187 159 189 0.84 9 9 1.3 1.6e+03 0.6 0.0 21 44 186 209 182 210 0.86
Sequence Information
- Coding Sequence
- ATGACCGCTCGCTGCTGGCACACCACCAGTGAGGTGCCCGCTTGTTGTTCACGCGACGTCAGCAAGACGACCGCTCGCTGCTGGCACACCACCAGTGAGGCGCCCGCTTGTTCTGCACCCGCCGTCAGAAAGACGACCGCTCGCTGCTGGCACGCCACCAGTGAGGTCCCCGCTTGTTGTTCACGTGCCGTCAGCAAGACGACCGCTCGCTGCTGGCACGCCACCAGTGAGGTGCCCGCTTGTTGTTCACGCGCCGTCAGCAATACGACCGCTCGCTGCTGGCACACCACCAGTGAGGCGCCCGATTGTTGTTCACGCACCGTCAGCAAGACGACCGCTCGCTGCTGGCACACCACCAGTGAGGTGCCCGCTTGTTGTTCACGCGCCGTCAGCAAGACGACCGTTCGCTGCTGGCACACCACCAGTGAGGTGCCCGCTTGTTGTTCACGCGCCGTCAGCAATACGACCGCTCGCTGCTGGCACACCACCAGTGAGGTGCCCGCTTGTTGTTCATGCGCCGTCAGCAAGACGACCGCTCGCTGCTGGCACACCACCAGTGAGGTGCCCGCTTGTTGTTCACGCGCCGTCAGCAAGACGACCGTTCGCTGCTGGCACACCACCAGTGAGGTGCTCGCTTATTGTTCAGGCGCCGTCCGCAAGACGACCGCTCGCTGCTGGCACACCGACGACCGCTTGCTGCTAGCACAGCACCAGTGA
- Protein Sequence
- MTARCWHTTSEVPACCSRDVSKTTARCWHTTSEAPACSAPAVRKTTARCWHATSEVPACCSRAVSKTTARCWHATSEVPACCSRAVSNTTARCWHTTSEAPDCCSRTVSKTTARCWHTTSEVPACCSRAVSKTTVRCWHTTSEVPACCSRAVSNTTARCWHTTSEVPACCSCAVSKTTARCWHTTSEVPACCSRAVSKTTVRCWHTTSEVLAYCSGAVRKTTARCWHTDDRLLLAQHQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -