Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.012 2.3e+02 3.7 0.0 23 46 30 53 25 58 0.87

2 5 0.071 1.4e+03 1.2 0.1 21 44 56 79 54 83 0.86

3 5 3.2e-06 0.064 15.1 0.0 20 44 83 107 80 115 0.92

4 5 0.11 2.2e+03 0.5 0.1 23 44 142 163 135 170 0.86

5 5 3.5e-06 0.07 14.9 0.1 25 53 172 200 165 201 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.012	2.3e+02	3.7	0.0	23	46	30	53	25	58	0.87
2	5	0.071	1.4e+03	1.2	0.1	21	44	56	79	54	83	0.86
3	5	3.2e-06	0.064	15.1	0.0	20	44	83	107	80	115	0.92
4	5	0.11	2.2e+03	0.5	0.1	23	44	142	163	135	170	0.86
5	5	3.5e-06	0.07	14.9	0.1	25	53	172	200	165	201	0.86

Coding Sequence: aTGAAGCCCTTCAAATGCGAAGTATGTGAAAAGGAATTCATTTTGAAAGTTCAACTTCAGGTTCACATGTATAAACATGGAAATGTCAAGCCTTTCAATTGTAGTATTTGTCAGAAAGCATTTACCGAAAAAAGTAAACTTTCACGACACATGGTTTTGCATTCCTCGGAAAAGAACTATATATGTCCAGATTGTGCGAAAGCATTTAAAAGCAAAGAATCTTTAAGAGTTCATTGTTTGATTCATAAGGCTGAAAAGCCGTTTGCTTGTACGATTTGTTCAGCAAAGTTTAACAATTCatcgaatttaaaaaaacatttagtgtCACATTcaaatgaaaAAGCTCATATGTGCGACCAGTGTGGAAGAAGATTTAAATTAAAGTGGGCTCTATCAGTCCATCGAAAGTCACATTTAAGAGTAAGGCCCCATTCATGTAACTTGTGCTCTAAGAGTTTTGTTAACTATAAGGATTTACAAAGACATACCTTAGTGCATTCAGAATCAAAAGGATACACGTGCGGCATCTGCCACACAAGTTTTCGACGCAAAGACAACCTACACCGCCATATGAAGAATACACACCCAGGTAAGAAGGGCGAGGTAATAAAGAATGCTTTGAATGAGCcagaaataccaaaaaaatccGTAGTCATTGATAATCCAAATGCTATAAAGGTGATAACCGCTTCGCCGGCTATTACAAAAAGTATAGCCGAGGCAGTGGTGGCGCCACTGCAGCAACATACTGCTAAATCTACTGATTCTAGGCCGACCGGATCTGTCATCAACGGACCAATCAAGCTCGCGTTTAAGACGCCGGCTTTCAAGAGCCATTACAATATTGCGAGttaCTTAACTAAAACTGGCAGAGCTGTTTGA
Protein Sequence: MKPFKCEVCEKEFILKVQLQVHMYKHGNVKPFNCSICQKAFTEKSKLSRHMVLHSSEKNYICPDCAKAFKSKESLRVHCLIHKAEKPFACTICSAKFNNSSNLKKHLVSHSNEKAHMCDQCGRRFKLKWALSVHRKSHLRVRPHSCNLCSKSFVNYKDLQRHTLVHSESKGYTCGICHTSFRRKDNLHRHMKNTHPGKKGEVIKNALNEPEIPKKSVVIDNPNAIKVITASPAITKSIAEAVVAPLQQHTAKSTDSRPTGSVINGPIKLAFKTPAFKSHYNIASYLTKTGRAV

Sequence clustering based on sequence similarity using MMseqs2