Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 4.5e-23 6.6e-21 73.9 0.0 14 107 2 95 1 98 0.94

2 2 0.59 88 2.7 0.0 80 109 100 129 95 130 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	4.5e-23	6.6e-21	73.9	0.0	14	107	2	95	1	98	0.94
2	2	0.59	88	2.7	0.0	80	109	100	129	95	130	0.88

Coding Sequence: ATGAAAATTGTCATTGGAGACGAGGAGTTTCCGGCCCACAAGATCATCCTCTCTGCGAATAGCCCTGTATTGACGACTATGTTCTCTACGAATATGCGTGAAGCTAATGAAAATCGACTTGTTGCGGAGGATATTGACACTGAGGCAATGAAGCTATTTCTGACTCATTTGTACACCGGTACTTACAACACCAAGGACAATACAGAGATGATTCCCGAGGTTTTGTATGGTGCTGATAAATATGATGTGAAAACCCTGAAGAAATTGTGTGAGCTTCAATTATCAGACAGATTGTCATTAGAAAATGTGCTCAAGATTGTTGATAAAGCTGATACTTACTACGCAGGTGCTTTAAAAGACTGTTGTATTGACTTTATGGTTAAAAACAATCAAAAAATAACTACTCATGCGGATTTTGACCCGCTCTGCTTGGCAAAACCCCATTTGATGCTTCGTTTCATCAAGGATGTTTCGTCTATATCAAAATGA
Protein Sequence: MKIVIGDEEFPAHKIILSANSPVLTTMFSTNMREANENRLVAEDIDTEAMKLFLTHLYTGTYNTKDNTEMIPEVLYGADKYDVKTLKKLCELQLSDRLSLENVLKIVDKADTYYAGALKDCCIDFMVKNNQKITTHADFDPLCLAKPHLMLRFIKDVSSISK

Sequence clustering based on sequence similarity using MMseqs2