g114097.t1
Basic Information
- Insect
- Diabrotica virgifera
- Gene Symbol
- Zfp64_2
- Assembly
- GCA_003013835.2
- Location
- PXJM02517868.1:334-768[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0002 1.2 12.0 0.0 21 46 6 31 3 37 0.90 2 5 1.9 1.1e+04 -0.7 0.3 21 30 34 43 30 47 0.86 3 5 0.00018 1.1 12.2 0.0 21 46 62 87 56 93 0.91 4 5 1.8 1.1e+04 -0.6 0.2 21 30 90 99 86 103 0.85 5 5 0.045 2.7e+02 4.5 0.0 21 43 118 140 113 144 0.88
Sequence Information
- Coding Sequence
- ATGAAAgttcatactggtgaaaaaccttataaatgtgaaatttgtggtAAGGTGTTTACTCAAAAAGGTAATTTAAAGTGTCATATGagaattcacactggtgaaacaccttataaatgtgaaatttgtagtaagcggTTTGGTCATCTAAGTGCTTTTACTTATCATATGAAAGTTCATAcaggtgaaaaaccttataaatgtgaaatttgtggtAAGGTGTTTACTCAAAAAGGTAATTTAAAGTGTCATATGagaattcacactggtgaaacaccttataaatgtgaaatttgtagtaagcagtttgGTCATCTAACTGCTTTCAGTTGTCATATGAAAgttcatactggtgaaaaaccttataaatgtgaaatttgtggtAAGCTGTTTACTCAAAAAGGTGATTTAAAGTGTCATGAGAATTCACACTAG
- Protein Sequence
- MKVHTGEKPYKCEICGKVFTQKGNLKCHMRIHTGETPYKCEICSKRFGHLSAFTYHMKVHTGEKPYKCEICGKVFTQKGNLKCHMRIHTGETPYKCEICSKQFGHLTAFSCHMKVHTGEKPYKCEICGKLFTQKGDLKCHENSH*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00437471;
- 90% Identity
- iTF_00437471;
- 80% Identity
- iTF_00437471;