Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.82 4.9e+03 0.5 0.0 25 46 10 31 3 37 0.69

2 6 0.065 3.9e+02 4.0 0.0 21 44 34 57 26 59 0.88

3 6 0.0036 21 8.0 0.3 20 44 61 85 54 88 0.83

4 6 0.0046 27 7.7 0.3 20 44 89 113 84 116 0.85

5 6 0.0018 11 9.0 0.2 20 47 117 144 112 150 0.82

6 6 0.0051 30 7.5 0.0 20 44 145 169 141 174 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.82	4.9e+03	0.5	0.0	25	46	10	31	3	37	0.69
2	6	0.065	3.9e+02	4.0	0.0	21	44	34	57	26	59	0.88
3	6	0.0036	21	8.0	0.3	20	44	61	85	54	88	0.83
4	6	0.0046	27	7.7	0.3	20	44	89	113	84	116	0.85
5	6	0.0018	11	9.0	0.2	20	47	117	144	112	150	0.82
6	6	0.0051	30	7.5	0.0	20	44	145	169	141	174	0.88

Coding Sequence: ATGAGAACGCACACTGCTGAAAAACTGTTTGGATGTGAAATATGCACAAAACAGTTTGTAACACAGAGTGAGTTAAAAAAACATATGATGGTGCATACTGGCGAAAAACCATTTGGATGTGAAATATGCACAAAACAGTTTTCACGAAGTGATAGCTTAAAAGTTCATATGAGAAGCCATACTAGTGAAAAACCATTTTGTTGTGAAATATGCACAAAACAGTTTTCACGAAGTGATAGCTTAAAAGTTCATATGAGAAGCCATACTAGTGAAAAACCATTTTGTTGTGAAATATGCACAAAACAGTTTTCACGAAGTGATAGCTTAAAAGTTCATATGAGAAGCCATACTAGTGAAAAACCATTTTGTTGTGAAATATGCACAAAACAGTTTTCACGAAGTGATAGCTTAAAAGTTCATATGAGAACCCATACTAGTGAAAAACCATTTGGATGTAAAATATGCACAAAACAATTTACACAAAATGCTCATTTGAAGGGCCACATGAGAACGCACATTGCTTAG
Protein Sequence: MRTHTAEKLFGCEICTKQFVTQSELKKHMMVHTGEKPFGCEICTKQFSRSDSLKVHMRSHTSEKPFCCEICTKQFSRSDSLKVHMRSHTSEKPFCCEICTKQFSRSDSLKVHMRSHTSEKPFCCEICTKQFSRSDSLKVHMRTHTSEKPFGCKICTKQFTQNAHLKGHMRTHIA*

Sequence clustering based on sequence similarity using MMseqs2